UniProtKB/Swiss-Prot P06702: Variant p.His20Arg

Protein S100-A9
Gene: S100A9
Feedback?

Variant information Variant position:

20 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Histidine (H) to Arginine (R) at position 20 (H20R, p.His20Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and polar (H) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Sequence information Variant position:

20 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

114 The length of the canonical sequence.
Location on the sequence:

MTCKMSQLERNIETIINTF H QYSVKLGHPDTLNQGEFKEL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         MTCKM-SQLERNIETIINTFHQYSVKLGHPDTLNQGEFKEL

Mouse                         MANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQ

Rat                           MAAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKE

Bovine                        MEDKM-SQMESSIETIINIFHQYSVRLGHYDTLIQKEFKQ

Rabbit                        MSCGM-SQLERSIDTIINVFHQYSVRVGPRDSLSQKEFKQ

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 114	Protein S100-A9
Domain	12 – 47	EF-hand 1
Binding site	20 – 20
Binding site	23 – 23
Binding site	26 – 26
Binding site	28 – 28
Binding site	30 – 30
Binding site	31 – 31
Binding site	36 – 36
Modified residue	2 – 2	Blocked amino end (Thr)
Modified residue	3 – 3	S-nitrosocysteine; transient
Mutagenesis	3 – 3	C -> A. Disrupts interaction with NOS2 and inhibits LDL(ox)-induced GAPDH S-nitrosylation; no effect on interaction with S100A8.
Mutagenesis	36 – 36	E -> Q. Loss of resistance to bacterial invasion; when associated with Q-78.
Helix	7 – 23

Literature citations
Human gene for migration inhibitory factor-related protein 14 (MRP14), variant allele.
Wang M.; Xu X.; Cai Y.; Xu H.; Han Y.; Xu Z.; Wu M.;
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANT ARG-20;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.