Home  |  Contact

UniProtKB/Swiss-Prot O43819: Variant p.Arg171Trp

Protein SCO2 homolog, mitochondrial
Gene: SCO2
Variant information

Variant position:  171
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Arginine (R) to Tryptophan (W) at position 171 (R171W, p.Arg171Trp).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to large size and aromatic (W)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Cardioencephalomyopathy, fatal infantile, due to cytochrome c oxidase deficiency 1 (CEMCOX1) [MIM:604377]: A disorder characterized by hypotonia, developmental delay, hypertrophic cardiomyopathy, lactic acidosis, gliosis, neuronal loss in basal ganglia, brainstem and spinal cord, and cytochrome c oxidase deficiency. {ECO:0000269|PubMed:10545952, ECO:0000269|PubMed:10749987, ECO:0000269|PubMed:11673586, ECO:0000269|PubMed:14994243, ECO:0000269|PubMed:17189203, ECO:0000269|PubMed:19336478, ECO:0000269|PubMed:19353847, ECO:0000269|PubMed:25959673}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In CEMCOX1; renders the protein unstable.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  171
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  266
The length of the canonical sequence.

Location on the sequence:   LEAEPGLPPVQPVFITVDPE  R DDVEAMARYVQDFHPRLLGL
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         LEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGL

Mouse                         LEAEPDLPLVQPVFITVDPERDDVAAMARYVQEFHPRLLGL

Bovine                        LEAEPGLPPVQPLFITVDPERDTVAAMARYVQDFHPRLLGL

Zebrafish                     LDKDPSLPSVQPLFITVDPERDDVSAMARYVKDFHPRLVGL

Baker's yeast                 LDDKDHIK-IQPLFISCDPARDTPDVLKEYLSDFHPAIIGL

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 42 – 266 Protein SCO2 homolog, mitochondrial
Topological domain 79 – 266 Mitochondrial intermembrane
Domain 85 – 259 Thioredoxin


Literature citations

Cooperation between COA6 and SCO2 in COX2 maturation during cytochrome c oxidase assembly links two mitochondrial cardiomyopathies.
Pacheu-Grau D.; Bareth B.; Dudek J.; Juris L.; Voegtle F.N.; Wissel M.; Leary S.C.; Dennerlein S.; Rehling P.; Deckers M.;
Cell Metab. 21:823-833(2015)
Cited for: INTERACTION WITH COA6; CHARACTERIZATION OF VARIANT MYP6 HIS-114; CHARACTERIZATION OF VARIANT CEMCOX1 TRP-171;

Mutations in SCO2 are associated with a distinct form of hypertrophic cardiomyopathy and cytochrome c oxidase deficiency.
Jaksch M.; Ogilvie I.; Yao J.; Kortenhaus G.; Bresser H.G.; Gerbitz K.D.; Shoubridge E.A.;
Hum. Mol. Genet. 9:795-801(2000)
Cited for: VARIANTS CEMCOX1 LYS-140 AND TRP-171;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.