UniProtKB/Swiss-Prot P26718: Variant p.Thr72Ala

NKG2-D type II integral membrane protein
Gene: KLRK1
Feedback?

Variant information Variant position:

72 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Threonine (T) to Alanine (A) at position 72 (T72A, p.Thr72Ala). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and polar (T) to small size and hydrophobic (A) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs2255336 [ dbSNP | Ensembl ]

Sequence information Variant position:

72 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

216 The length of the canonical sequence.
Location on the sequence:

PFFFCCFIAVAMGIRFIIMV T IWSAVFLNSLFNQEVQIPLT The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         PFFFCCFIAVAMGIRFIIMVTIWSAVFLNS----LFNQEVQIPLT

Rhesus macaque                PLFFCCFIAVAMGIRFIIMVTIWSAVFLNS----LFNQEVQ

Chimpanzee                    PFFFCCFIAVAMGIRFIIMVTIWSAVFLNS----LFNQEVQ

Mouse                         PMFVVRVLAIALAIRFTLNTLMWLAIFKETFQPVLCNKEVP

Rat                           PLFVVRVLVAAMTIRFTVITLTWLAVFITL----LCNKEVS

Pig                           PFFLARSIAIAMGIRFIVMVMIYSGMIINL----LFNQEAP

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 216	NKG2-D type II integral membrane protein
Transmembrane	52 – 72	Helical; Signal-anchor for type II membrane protein
Mutagenesis	66 – 66	R -> A. Inhibits association with the HCST signaling dimer.

Literature citations
DNA sequence analysis of NKG2, a family of related cDNA clones encoding type II integral membrane proteins on human natural killer cells.
Houchins J.P.; Yabe T.; McSherry C.; Bach F.H.;
J. Exp. Med. 173:1017-1020(1991)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); VARIANT ALA-72; The genomic organization of NKG2C, E, F, and D receptor genes in the human natural killer gene complex.
Glienke J.; Sobanov Y.; Brostjan C.; Steffens C.; Nguyen C.; Lehrach H.; Hofer E.; Francis F.;
Immunogenetics 48:163-173(1998)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANT ALA-72; Identification and characterization of the NKG2D gene from large granular lymphocytic leukemia (LGL) cells.
Kothapalli R.; Kusmartseva I.; Loughran T.P. Jr.;
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); VARIANT ALA-72; Conservation and variation in human and common chimpanzee CD94 and NKG2 genes.
Shum B.P.; Flodin L.R.; Muir D.G.; Rajalingam R.; Khakoo S.I.; Cleland S.; Guethlein L.A.; Uhrberg M.; Parham P.;
J. Immunol. 168:240-252(2002)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); VARIANT ALA-72; The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
The MGC Project Team;
Genome Res. 14:2121-2127(2004)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1); VARIANT ALA-72;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.