UniProtKB/Swiss-Prot Q07812: Variant p.Gly108Val

Apoptosis regulator BAX
Gene: BAX
Feedback?

Variant information Variant position:

108 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

US The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Glycine (G) to Valine (V) at position 108 (G108V, p.Gly108Val). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from glycine (G) to medium size and hydrophobic (V) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

In a Burkitt lymphoma; loss of homodimerization. Any additional useful information about the variant.

Sequence information Variant position:

108 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

192 The length of the canonical sequence.
Location on the sequence:

PREVFFRVAADMFSDGNFNW G RVVALFYFASKLVLKALCTK The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         PREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTK

Mouse                         PREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTK

Rat                           PREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTK

Bovine                        PREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTK

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 192	Apoptosis regulator BAX
Motif	98 – 118	BH1
Cross	128 – 128	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Alternative sequence	42 – 192	Missing. In isoform Gamma.
Mutagenesis	128 – 128	K -> R. Partial loss of polyubiquitination.
Helix	107 – 147

Literature citations
Bax mutations in cell lines derived from hematological malignancies.
Meijerink J.P.P.; Smetsers T.F.C.M.; Sloetjes A.W.; Linders E.H.P.; Mensink E.J.B.M.;
Leukemia 9:1828-1832(1995)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 63-77 AND 98-118; VARIANTS ARG-67 AND VAL-108; Hematopoietic malignancies demonstrate loss-of-function mutations of BAX.
Meijerink J.P.P.; Mensink E.J.B.M.; Wang K.; Sedlak T.W.; Sloetjes A.W.; de Witte T.; Waksman G.; Korsmeyer S.J.;
Blood 91:2991-2997(1998)
Cited for: VARIANTS GLU-11; ARG-67 AND VAL-108;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.