Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P16410: Variant p.Thr17Ala

Cytotoxic T-lymphocyte protein 4
Gene: CTLA4
Feedback?
Variant information Variant position: help 17 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Threonine (T) to Alanine (A) at position 17 (T17A, p.Thr17Ala). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (T) to small size and hydrophobic (A) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism: help Genetic variations in CTLA4 are associated with susceptibility to several autoimmune disorders (PubMed:10189842, PubMed:10924276, PubMed:12724780, PubMed:15138458, PubMed:15657618, PubMed:15688186, PubMed:18595775, PubMed:25213377, PubMed:25329329). They influence responsiveness to hepatitis B virus (HBV) infection [MIM:610424] (PubMed:15452244). Additional information on the polymorphism described.
Variant description: help Increased risk for Graves disease, insulin-dependent diabetes mellitus, thyroid-associated orbitopathy, systemic lupus erythematosus and susceptibility to HBV infection. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 17 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 223 The length of the canonical sequence.
Location on the sequence: help MACLGFQRHKAQLNLA T RTWPCTLLFFLLFIPVFCKA The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKA

                              MAGFGFRRHGVQPDLASRTWPCTALFSLLFIPVFSKG

Mouse                         MACLGLRRYKAQLQLPSRTWPFVALLTLLFIPVFSEA

Pig                           MACSGFQSHGAWLELTSRTWPCTALFSLLFIPVFSKG

Rabbit                        MARLGFQRQGTQLDLASRTWSCAALFSLLFLPVFSKA

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Signal peptide 1 – 35



Literature citations
CTLA-4 and CD28 activated lymphocyte molecules are closely related in both mouse and human as to sequence, message expression, gene structure, and chromosomal location.
Harper K.; Balzano C.; Rouvier E.; Mattei M.-G.; Luciani M.-F.; Golstein P.;
J. Immunol. 147:1037-1044(1991)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1); TISSUE SPECIFICITY; ALTERNATIVE SPLICING; VARIANT ALA-17; Identification of CTLA-4 isoforms produced by alternative splicing and their association with myasthenia gravis.
Gu M.; Kakoulidou M.; Giscombe R.; Pirskanen R.; Lefvert A.K.; Klareskog L.; Wang X.;
Clin. Immunol. 128:374-381(2008)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4); VARIANT ALA-17; ALTERNATIVE SPLICING; POLYMORPHISM; Insulin-dependent diabetes mellitus (IDDM) is associated with CTLA4 polymorphisms in multiple ethnic groups.
Marron M.P.; Raffel L.J.; Garchon H.-J.; Jacob C.O.; Serrano-Rios M.; Martinez Larrad M.T.; Teng W.-P.; Park Y.; Zhang Z.-X.; Goldstein D.R.; Tao Y.-W.; Beaurain G.; Bach J.-F.; Huang H.-S.; Luo D.-F.; Zeidler A.; Rotter J.I.; Yang M.C.K.; Modilevsky T.; Maclaren N.K.; She J.-X.;
Hum. Mol. Genet. 6:1275-1282(1997)
Cited for: VARIANT ALA-17; INVOLVEMENT IN T1D12; Cytotoxic T lymphocyte antigen-4 (CTLA-4) gene polymorphism confers susceptibility to thyroid associated orbitopathy.
Vaidya B.; Imrie H.; Perros P.; Dickinson J.; McCarthy M.I.; Kendall-Taylor P.; Pearce S.H.S.;
Lancet 354:743-744(1999)
Cited for: VARIANT ALA-17; INVOLVEMENT IN THYROID ASSOCIATED ORBITOPATHY; Complex association analysis of Graves disease using a set of polymorphic markers.
Chistyakov D.A.; Savost'anov K.V.; Turakulov R.I.; Petunina N.A.; Trukhina L.V.; Kudinova A.V.; Balabolkin M.I.; Nosikov V.V.;
Mol. Genet. Metab. 70:214-218(2000)
Cited for: POLYMORPHISM; VARIANT ALA-17; INVOLVEMENT IN GRAVES DISEASE; Familial primary pulmonary hypertension (gene PPH1) is caused by mutations in the bone morphogenetic protein receptor-II gene.
Deng Z.; Morse J.H.; Slager S.L.; Cuervo N.; Moore K.J.; Venetos G.; Kalachikov S.; Cayanis E.; Fischer S.G.; Barst R.J.; Hodge S.E.; Knowles J.A.;
Am. J. Hum. Genet. 67:737-744(2000)
Cited for: VARIANT ALA-17; Cytotoxic T-lymphocyte antigen 4 gene and recovery from hepatitis B virus infection.
Thio C.L.; Mosbruger T.L.; Kaslow R.A.; Karp C.L.; Strathdee S.A.; Vlahov D.; O'Brien S.J.; Astemborski J.; Thomas D.L.;
J. Virol. 78:11258-11262(2004)
Cited for: POLYMORPHISM; INVOLVEMENT IN SUSCEPTIBILITY TO HBV INFECTION; VARIANT ALA-17;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.