Home  |  Contact

UniProtKB/Swiss-Prot P05067: Variant p.Glu693Gly

Amyloid-beta precursor protein
Gene: APP
Variant information

Variant position:  693
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LP/P [Disclaimer]
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Glutamate (E) to Glycine (G) at position 693 (E693G, p.Glu693Gly).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and acidic (E) to glycine (G)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In AD1.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  693
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  770
The length of the canonical sequence.

Location on the sequence:   AEFRHDSGYEVHHQKLVFFA  E DVGSNKGAIIGLMVGGVVIA
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         AEFRHD----------------SGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Chimpanzee                    AEFRHD----------------SGYEVHHQKLVFFAEDVGS

Mouse                         AEFGHD----------------SGFEVRHQKLVFFAEDVGS

Rat                           AEFGHD----------------SGFEVRHQKLVFFAEDVGS

Pig                           AEFRHD----------------SGYEVHHQKLVFFAEDVGS

Caenorhabditis elegans        IEPIIDEP--------------ASFY-RHDKLIQSPEVERS

Drosophila                    VAHQEAEPQVQHFMTHDLGHRESSFS-LRREFAQHAHAAKE

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 18 – 770 Amyloid-beta precursor protein
Chain 672 – 770 C99
Chain 672 – 713 Amyloid-beta protein 42
Chain 672 – 711 Amyloid-beta protein 40
Chain 688 – 770 C83
Peptide 688 – 713 P3(42)
Peptide 688 – 711 P3(40)
Chain 691 – 770 C80
Topological domain 18 – 701 Extracellular
Metal binding 677 – 677 Cu(2+) 2
Metal binding 677 – 677 Zn(2+)
Metal binding 681 – 681 Cu(2+) 2
Metal binding 681 – 681 Zn(2+)
Metal binding 684 – 684 Cu(2+) 2
Metal binding 684 – 684 Zn(2+)
Metal binding 685 – 685 Cu(2+) 2
Metal binding 685 – 685 Zn(2+)
Site 704 – 704 Implicated in free radical propagation
Site 706 – 706 Susceptible to oxidation
Glycosylation 681 – 681 O-linked (HexNAc...) tyrosine; partial
Alternative sequence 306 – 770 Missing. In isoform APP305.
Mutagenesis 676 – 676 R -> G. 60-70% zinc-induced amyloid-beta protein 28 aggregation.
Mutagenesis 681 – 681 Y -> F. 60-70% zinc-induced amyloid-beta protein 28 aggregation.
Mutagenesis 684 – 684 H -> R. Only 23% zinc-induced amyloid-beta protein 28 aggregation.
Mutagenesis 695 – 695 V -> C. Causes formation of an artifactual disulfide bond with PSEN1.
Mutagenesis 704 – 704 G -> V. Reduced protein oxidation. No hippocampal neuron toxicity.
Mutagenesis 706 – 706 M -> L. Reduced lipid peroxidation inhibition.
Mutagenesis 706 – 706 M -> V. No free radical production. No hippocampal neuron toxicity.
Beta strand 692 – 694


Literature citations

Linkage and mutational analysis of familial Alzheimer disease kindreds for the APP gene region.
Kamino K.; Orr H.T.; Payami H.; Wijsman E.M.; Alonso M.E.; Pulst S.M.; Anderson L.; O'Dahl S.; Nemens E.; White J.A.; Sadovnick A.D.; Ball M.J.; Kaye J.; Warren A.; McInnis M.G.; Antonarakis S.E.; Korenberg J.R.; Sharma V.; Kukull W.; Larson E.; Heston L.L.; Martin G.M.; Bird T.D.; Schellenberg G.D.;
Am. J. Hum. Genet. 51:998-1014(1992)
Cited for: VARIANT AD1 GLY-693;

The 'Arctic' APP mutation (E693G) causes Alzheimer's disease by enhanced Abeta protofibril formation.
Nilsberth C.; Westlind-Danielsson A.; Eckman C.B.; Condron M.M.; Axelman K.; Forsell C.; Stenh C.; Luthman J.; Teplow D.B.; Younkin S.G.; Naeslund J.; Lannfelt L.;
Nat. Neurosci. 4:887-893(2001)
Cited for: VARIANT AD1 GLY-693;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.