Home  |  Contact

UniProtKB/Swiss-Prot P02730: Variant p.Ala858Asp

Band 3 anion transport protein
Gene: SLC4A1
Variant information

Variant position:  858
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Alanine (A) to Aspartate (D) at position 858 (A858D, p.Ala858Asp).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from small size and hydrophobic (A) to medium size and acidic (D)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Renal tubular acidosis, distal, autosomal dominant (AD-dRTA) [MIM:179800]: An autosomal dominant disease characterized by reduced ability to acidify urine, variable hyperchloremic hypokalemic metabolic acidosis, nephrocalcinosis, and nephrolithiasis. It is due to functional failure of alpha-intercalated cells of the cortical collecting duct of the distal nephron, where vectorial proton transport is required for urinary acidification. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In AD-dRTA; impairs expression at the cell membrane.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  858
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  911
The length of the canonical sequence.

Location on the sequence:   GIQIICLAVLWVVKSTPASL  A LPFVLILTVPLRRVLLPLIF
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         GIQIICLAVLWVVKSTPASLALPFVLILTVPLRRVLLPLIF

Mouse                         GIQIICLAVLWVVKSTPASLALPFVLILTVPLRRLILPLIF

Rat                           GIQIICLAVLWVVKSTPASLALPFVLILTVPLRRLLLPLIF

Chicken                       LTQILVVALLWGVKVSPASLRCPFVLVLTVPLRRLLLPRIF

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 911 Band 3 anion transport protein
Intramembrane 839 – 869 Discontinuously helical
Lipidation 843 – 843 S-palmitoyl cysteine
Helix 854 – 858


Literature citations

Band 3 mutations, renal tubular acidosis and South-East Asian ovalocytosis in Malaysia and Papua New Guinea: loss of up to 95% band 3 transport in red cells.
Bruce L.J.; Wrong O.; Toye A.M.; Young M.T.; Ogle G.; Ismail Z.; Sinha A.K.; McMaster P.; Hwaihwanje I.; Nash G.B.; Hart S.; Lavu E.; Palmer R.; Othman A.; Unwin R.J.; Tanner M.J.A.;
Biochem. J. 350:41-51(2000)
Cited for: VARIANTS DRTA-HA ASP-701 AND VAL-850 DEL; VARIANT AD-DRTA ASP-858; FUNCTION; SUBCELLULAR LOCATION; TISSUE SPECIFICITY;

Impaired trafficking and intracellular retention of mutant kidney anion exchanger 1 proteins (G701D and A858D) associated with distal renal tubular acidosis.
Ungsupravate D.; Sawasdee N.; Khositseth S.; Udomchaiprasertkul W.; Khoprasert S.; Li J.; Reithmeier R.A.; Yenchitsomanus P.T.;
Mol. Membr. Biol. 27:92-103(2010)
Cited for: CHARACTERIZATION OF VARIANT DRTA-HA ASP-701; CHARACTERIZATION OF VARIANT AD-DRTA ASP-858; SUBUNIT; SUBCELLULAR LOCATION; FUNCTION;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.