Home  |  Contact

UniProtKB/Swiss-Prot P23142: Variant p.Gln141Arg

Fibulin-1
Gene: FBLN1
Variant information

Variant position:  141
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LB/B
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Glutamine (Q) to Arginine (R) at position 141 (Q141R, p.Gln141Arg).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (Q) to large size and basic (R)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  141
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  703
The length of the canonical sequence.

Location on the sequence:   AQGQSCEYSLMVGYQCGQVF  Q ACCVKSQETGDLDVGGLQET
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         AQGQSCEYSLMVGYQCGQVFQACCVKSQE-TGDLDVG---GLQET

Mouse                         ARDQTCEPIVMISYQCGLVFRACCVKARE-NSDFVQGNGAD

Chicken                       VQGQSCEPNLKIGYQCGIVFRACCVKGQE-GTDVSISDDAP

Zebrafish                     IRVSPVSSVCRWSISRGPGVRSCCVDKQP-AHGVQPSKGDA

Caenorhabditis elegans        NRNEPCVAPVGFSAGCLRSFNKCCNGDIEITHASEIITGRP

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 30 – 703 Fibulin-1
Domain 112 – 144 Anaphylatoxin-like 3
Disulfide bond 113 – 143
Disulfide bond 126 – 144


Literature citations

Fibulin is an extracellular matrix and plasma glycoprotein with repeated domain structure.
Argraves W.S.; Tran H.; Burgess W.H.; Dickerson K.;
J. Cell Biol. 111:3155-3164(1990)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; B AND C); VARIANT ARG-141;

Human fibulin-1D: molecular cloning, expression and similarity with S1-5 protein, a new member of the fibulin gene family.
Tran H.; Mattei M.-G.; Godyna S.; Argraves W.S.;
Matrix Biol. 15:479-493(1997)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM D); TISSUE SPECIFICITY; VARIANT ARG-141; INTERACTION WITH FN1 AND FGB;

Translational control of specific genes during differentiation of HL-60 cells.
Krichevsky A.M.; Metzer E.; Rosen H.;
J. Biol. Chem. 274:14295-14305(1999)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM D); VARIANTS ARG-141 AND ARG-695;

Large-scale cDNA transfection screening for genes related to cancer development and progression.
Wan D.; Gong Y.; Qin W.; Zhang P.; Li J.; Wei L.; Zhou X.; Li H.; Qiu X.; Zhong F.; He L.; Yu J.; Yao G.; Jiang H.; Qian L.; Yu Y.; Shu H.; Chen X.; Xu H.; Guo M.; Pan Z.; Chen Y.; Ge C.; Yang S.; Gu J.;
Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C); VARIANT ARG-141;

The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
The MGC Project Team;
Genome Res. 14:2121-2127(2004)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C); VARIANT ARG-141;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.