Home  |  Contact
Due to maintenance work, this service will be unavailable Mon Feb 13 between 07:00 and 09:30 - CET. Apologies for the inconvenience.

UniProtKB/Swiss-Prot P01241: Variant p.Arg103Cys

Somatotropin
Gene: GH1
Variant information

Variant position:  103
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LP/P [Disclaimer]
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Arginine (R) to Cysteine (C) at position 103 (R103C, p.Arg103Cys).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to medium size and polar (C)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In KWKS; no effect on GHR signaling pathway; does not affect interaction with GHR; results in a stronger interaction with GHBP; does not affect subcellular location.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  103
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  217
The length of the canonical sequence.

Location on the sequence:   SIPTPSNREETQQKSNLELL  R ISLLLIQSWLEPVQFLRSVF
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         SIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVF

Rhesus macaque                SIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVF

Chimpanzee                    SIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVF

Mouse                         TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIF

Rat                           TIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIF

Pig                           TIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVF

Bovine                        TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVF

Rabbit                        TIPAPTGKDEAQQRSDMELLRFSLLLIQSWLGPVQFLSRAF

Goat                          TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVF

Sheep                         TIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVF

Cat                           TIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVF

Horse                         TIPAPTGKDEAQQRSDMELLRFSLLLIQSWLGPVQLLSRVF

Chicken                       TIPAPTGKDDAQQKSDMELLRFSLVLIQSWLTPVQYLSKVF

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 27 – 217 Somatotropin
Disulfide bond 79 – 191
Helix 98 – 110


Literature citations

Short stature caused by a mutant growth hormone.
Takahashi Y.; Kaji H.; Okimura Y.; Goji K.; Abe H.; Chihara K.;
N. Engl. J. Med. 334:432-436(1996)
Cited for: VARIANT KWKS CYS-103;

Evaluation of the biological activity of a growth hormone (GH) mutant (R77C) and its impact on GH responsiveness and stature.
Petkovic V.; Besson A.; Thevis M.; Lochmatter D.; Eble A.; Fluck C.E.; Mullis P.E.;
J. Clin. Endocrinol. Metab. 92:2893-2901(2007)
Cited for: CHARACTERIZATION OF VARIANT KWKS CYS-103;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.