Home  |  Contact

UniProtKB/Swiss-Prot P22301: Variant p.Gly15Arg

Interleukin-10
Gene: IL10
Feedback?
Variant information Variant position: help 15 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Glycine (G) to Arginine (R) at position 15 (G15R, p.Gly15Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism: help A polymorphism in IL10 promoter region is associated with resistance to graft-versus-host disease (GVHDS) [MIM:614395]. GVHDS is a major complication of allogeneic bone marrow transplantation, in which mature donor T-cells that contaminate the allogeneic bone marrow recognize the tissues of the recipient as foreign, causing a severe inflammatory disease. Additional information on the polymorphism described.
Variant description: help In a family affected by Crohn disease; decreases secretion thereby reducing the anti-inflammatory effect. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 15 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 178 The length of the canonical sequence.
Location on the sequence: help MHSSALLCCLVLLT G VRASPGQGTQSENSCTHFPG The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPG

Rhesus macaque                MHSSALLCCLVLLTGVRASPGQGTQSENSCTRFPG

Chimpanzee                    MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPG

Mouse                         MPGSALLCCLLLLTGMRISRGQYSREDNNCTHFPV

Rat                           MPGSALLCCLLLLAGVKTSKGHSIRGDNNCTHFPV

Pig                           MPSSALLYCLIFLAGVAAS----IKSENSCIHFPT

Bovine                        MHSSALLCCLVFLAGVAASRDASTLSDSSCIHLPT

Rabbit                        MLSSALLCCLVFLGGTGASRGQDTPAENSCIHFPG

Sheep                         PSSSAVLCCLVFLAGVAASRDASTLSDSSCTHFPA

Cat                           MHSSALLCFLVFLAGVGASRHQSTLSEDNCTHFSV

Horse                         MHSSALLCYLVFLAGVGASRDRGTQSENSCTHFPT

Chicken                       ----MQTCCQALLLLLAACTLPAHCLEPTCLHFSE

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Signal peptide 1 – 18



Literature citations
A Gly15Arg mutation in the interleukin-10 gene reduces secretion of interleukin-10 in Crohn disease.
van der Linde K.; Boor P.P.; Sandkuijl L.A.; Meijssen M.A.; Savelkoul H.F.; Wilson J.H.; de Rooij F.W.;
Scand. J. Gastroenterol. 38:611-617(2003)
Cited for: VARIANT ARG-15;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.