Home  |  Contact

UniProtKB/Swiss-Prot P06213: Variant p.Arg1158Gln

Insulin receptor
Gene: INSR
Variant information

Variant position:  1158
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Arginine (R) to Glutamine (Q) at position 1158 (R1158Q, p.Arg1158Gln).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to medium size and polar (Q)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Diabetes mellitus, non-insulin-dependent (NIDDM) [MIM:125853]: A multifactorial disorder of glucose homeostasis caused by a lack of sensitivity to the body's own insulin. Affected individuals usually have an obese body habitus and manifestations of a metabolic syndrome characterized by diabetes, insulin resistance, hypertension and hypertriglyceridemia. The disease results in long-term complications that affect the eyes, kidneys, nerves, and blood vessels. {ECO:0000269|PubMed:1470163, ECO:0000269|PubMed:1607076, ECO:0000269|PubMed:7657032}. Note=The gene represented in this entry may be involved in disease pathogenesis.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In NIDDM.
Any additional useful information about the variant.



Sequence information

Variant position:  1158
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1382
The length of the canonical sequence.

Location on the sequence:   QMAAEIADGMAYLNAKKFVH  R DLAARNCMVAHDFTVKIGDF
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         QMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDF

Mouse                         QMTAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDF

Rat                           QMTAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDF

Xenopus laevis                QMAAEISDGMAYLNAKKFVHRDLAARNCMVADDYAVKIGDF

Caenorhabditis elegans        EWAAQICDGMAYLESLKFCHRDLAARNCMINRDETVKIGDF

Drosophila                    QMAIEIADGMAYLAAKKFVHRDLAARNCMVADDLTVKIGDF

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 763 – 1382 Insulin receptor subunit beta
Topological domain 980 – 1382 Cytoplasmic
Domain 1023 – 1298 Protein kinase
Active site 1159 – 1159 Proton donor/acceptor
Binding site 1177 – 1177 ATP
Mutagenesis 1159 – 1159 D -> N. Loss of kinase activity.
Mutagenesis 1163 – 1163 R -> Q. Loss of kinase activity.


Literature citations

Insulin receptor Arg1131-->Gln: a novel mutation in the catalytic loop of insulin receptor observed in insulin resistant diabetes.
Kasuga M.; Kishimoto M.; Hashiramoto M.; Yonezawa K.; Kazumi T.; Hagino H.; Shii K.;
Nihon Geka Gakkai Zasshi 93:968-971(1992)
Cited for: VARIANT NIDDM GLN-1158;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.