Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q99684: Variant p.Asn382Ser

Zinc finger protein Gfi-1
Gene: GFI1
Feedback?
Variant information Variant position: help 382 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Asparagine (N) to Serine (S) at position 382 (N382S, p.Asn382Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (N) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In SCN2; zero neutrophil count. marked monocytosis and reduced T- and B-lymphocyte number leading to recurrent infectious complications. Abolishes recognition of DNA binding site of zinc finger. Diminished repression activity and elevated ELA2 expression. No effect on repression of CDKN1A/p21 transcription. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 382 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 422 The length of the canonical sequence.
Location on the sequence: help HTGEKPHKCQVCGKAFSQSS N LITHSRKHTGFKPFGCDLCG The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         HTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCG

                              HTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCG

Mouse                         HTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCG

Rat                           HTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCG

Drosophila                    HTGEKPHKCTVCLKAFSQSSNLITHMRKHTGYKPFGCHLCD
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 422 Zinc finger protein Gfi-1
Zinc finger 368 – 390 C2H2-type 5



Literature citations
A role of Miz-1 in Gfi-1-mediated transcriptional repression of CDKN1A.
Liu Q.; Basu S.; Qiu Y.; Tang F.; Dong F.;
Oncogene 29:2843-2852(2010)
Cited for: INTERACTION WITH ZBTB17; FUNCTION; INDUCTION; CHARACTERIZATION OF VARIANT SER-382; Mutations in proto-oncogene GFI1 cause human neutropenia and target ELA2.
Person R.E.; Li F.-Q.; Duan Z.; Benson K.F.; Wechsler J.; Papadaki H.A.; Eliopoulos G.; Kaufman C.; Bertolone S.J.; Nakamoto B.; Papayannopoulou T.; Grimes H.L.; Horwitz M.;
Nat. Genet. 34:308-312(2003)
Cited for: VARIANT NI-CINA ARG-403; VARIANT SCN2 SER-382; CHARACTERIZATION OF VARIANTS NI-CINA ARG-403 AND SCN2 SER-382; FUNCTION;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.