UniProtKB/Swiss-Prot P28067: Variant p.Arg210His

HLA class II histocompatibility antigen, DM alpha chain
Gene: HLA-DMA
Feedback?

Variant information Variant position:

210 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Arginine (R) to Histidine (H) at position 210 (R210H, p.Arg210His). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from large size and basic (R) to medium size and polar (H) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Polymorphism:

The following alleles of DMA are known: DMA*01:01, DMA*01:02, DMA*01:03 (DMA3.2) and DMA*01:04 (DMA3.4). The sequence shown is that of DMA*01:01. Additional information on the polymorphism described.
Variant description:

In allele DMA*01:03. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs41555121 [ dbSNP | Ensembl ]

Sequence information Variant position:

210 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

261 The length of the canonical sequence.
Location on the sequence:

LNFTPEPSDIFSCIVTHEID R YTAIAYWVPRNALPSDLLEN The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         LNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLEN

Mouse                         LNFTPEPFDLYSCTVTHEIDRYTAIAYWVPQNALPSDLLEN

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	27 – 261	HLA class II histocompatibility antigen, DM alpha chain
Topological domain	27 – 233	Lumenal
Domain	121 – 215	Ig-like C1-type
Region	125 – 217	Alpha-2
Mutagenesis	199 – 199	I -> N. Decreases the interaction with MHCII and peptide exchange.
Mutagenesis	220 – 220	R -> A. Decreases the interaction with MHCII and peptide exchange; when associated with A-124.
Turn	207 – 210

Literature citations
No reference for the current variant in UniProtKB/Swiss-Prot.

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.