Home  |  Contact

UniProtKB/Swiss-Prot P30793: Variant p.Gly83Ala

GTP cyclohydrolase 1
Gene: GCH1
Chromosomal location: 14q22.1-q22.2
Variant information

Variant position:  83
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Glycine (G) to Alanine (A) at position 83 (G83A, p.Gly83Ala).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from glycine (G) to small size and hydrophobic (A)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Dystonia, dopa-responsive (DRD) [MIM:128230]: A form of dystonia that responds to L-DOPA treatment without side effects. Dystonia is defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. DRD typically presents in childhood with walking problems due to dystonia of the lower limbs and worsening of the dystonia towards the evening. It is characterized by postural and motor disturbances showing marked diurnal fluctuation. Torsion of the trunk is unusual. Symptoms are alleviated after sleep and aggravated by fatigue and exercise. {ECO:0000269|PubMed:10076897, ECO:0000269|PubMed:10208576, ECO:0000269|PubMed:10582612, ECO:0000269|PubMed:10825351, ECO:0000269|PubMed:10987649, ECO:0000269|PubMed:11113234, ECO:0000269|PubMed:12391354, ECO:0000269|PubMed:17101830, ECO:0000269|PubMed:7501255, ECO:0000269|PubMed:7874165, ECO:0000269|PubMed:8852666, ECO:0000269|PubMed:8957022, ECO:0000269|PubMed:9120469, ECO:0000269|PubMed:9328244, ECO:0000269|PubMed:9778264}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In DRD.
Any additional useful information about the variant.



Sequence information

Variant position:  83
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  250
The length of the canonical sequence.

Location on the sequence:   DNELNLPNLAAAYSSILSSL  G ENPQRQGLLKTPWRAASAMQ
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         DN-----------------------ELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQ

Mouse                         EN-----------------------QVNLPKLAAAYSSILL

Rat                           DN-----------------------ELNLPNLAAAYSSILR

Chicken                       DN-----------------------ELSLPSLAAAYTTILR

Caenorhabditis elegans        ED-------------------------HLKSMCNAYQSIIQ

Drosophila                    TSTTPGHEKCTFHHDLELDHKPPTREALLPDMARSYRLLLG

Slime mold                    E--------------------------VLNTMQSSVKTLLS

Baker's yeast                 EE-----------------------KERIQRISGAIKTILT

Fission yeast                 E--------------------------KVKKISNAISTILE

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 250 GTP cyclohydrolase 1
Modified residue 81 – 81 Phosphoserine


Literature citations

Dopa-responsive dystonia: a clinical and molecular genetic study.
Bandmann O.; Valente E.M.; Holmans P.; Surtees R.A.; Walters J.H.; Wevers R.A.; Marsden C.D.; Wood N.W.;
Ann. Neurol. 44:649-656(1998)
Cited for: VARIANTS DRD GLN-71; VAL-74; ALA-83; ILE-191; VAL-211 AND TRP-241;

Levodopa-responsive dystonia. GTP cyclohydrolase I or parkin mutations?
Tassin J.; Duerr A.; Bonnet A.-M.; Gil R.; Vidailhet M.; Luecking C.B.; Goas J.-Y.; Durif F.; Abada M.; Echenne B.; Motte J.; Lagueny A.; Lacomblez L.; Jedynak P.; Bartholome B.; Agid Y.; Brice A.;
Brain 123:1112-1121(2000)
Cited for: VARIANTS DRD ALA-83; 88-ARG-GLN-89 DEL; SER-178; ARG-180; LEU-199 AND GLU-201;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.