UniProtKB/SwissProt variant VAR

Variant information

Variant position:

492

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:

LB/B

The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Proline (P) to Arginine (R) at position 492 (P492R, p.Pro492Arg).

Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:

Change from medium size and hydrophobic (P) to large size and basic (R)

The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:

-2

The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Variant description:

In allele CYP1A1*11.

Any additional useful information about the variant.

Other resources:

Links to websites of interest for the variant.

Variant rs28399430 [ dbSNP | Ensembl ]

Sequence information

Variant position:

492

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:

512

The length of the canonical sequence.

Location on the sequence:

AILLQRVEFSVPLGVKVDMT P IYGLTMKHACCEHFQMQLRS

The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         AILLQRVEFSVPLGVKVDMTPIYGLTMKHACCEHFQMQLRS--------

                              AILLQQVEFSVPEGTKVDMTPIYGLTMKHARCEHFQVRVRT

Rhesus macaque                AILLQRVEFSVPPGVKVDMTPIYGLTMKHACCEHFQMQLRS

Mouse                         AILLQQIEFKVSPGEKVDMTPTYGLTLKHARCEHFQVQMRS

Rat                           AILLQQMEFNVSPGEKVDMTPAYGLTLKHARCEHFQVQMRS

Rabbit                        ATLLQQVEFSVSPGTTVDMTPIYGLTMKHARCEHFQAKLRF

Sheep                         AILLHQVEFHVTPGVKVDMTPLYGLTMKHARCEHFQVRIRS

Cat                           AILLQQVEFSVPQGTKVDMTPIYGLTMKHARCEHFQVRMRT

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 512	Cytochrome P450 1A1
Alternative sequence	190 – 512	Missing. In isoform 2.
Alternative sequence	419 – 512	Missing. In isoform 3.

Literature citations

Novel nonsynonymous polymorphisms of the CYP1A1 Gene in Japanese.
Saito M.; Egashira M.; Kiyotani K.; Fujieda M.; Yamazaki H.; Kiyohara C.; Kunitoh H.; Kamataki T.;
Drug Metab. Pharmacokinet. 18:218-222(2003)
Cited for: VARIANTS ASN-448; CYS-464; TRP-477 AND ARG-492;

Genetic variation in eleven phase I drug metabolism genes in an ethnically diverse population.
Solus J.F.; Arietta B.J.; Harris J.R.; Sexton D.P.; Steward J.Q.; McMunn C.; Ihrie P.; Mehall J.M.; Edwards T.L.; Dawson E.P.;
Pharmacogenomics 5:895-931(2004)
Cited for: VARIANTS ASP-45; THR-78; TRP-93; ARG-173; ASN-461; MET-482 AND ARG-492;

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P04798: Variant p.Pro492Arg