Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q13285: Variant p.Arg92Gln

Steroidogenic factor 1
Gene: NR5A1
Feedback?
Variant information Variant position: help 92 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Arginine (R) to Glutamine (Q) at position 92 (R92Q, p.Arg92Gln). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to medium size and polar (Q) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In SRXY3, SRXX4 and AINR; decreased transactivator activity; no effect on nuclear location. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 92 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 461 The length of the canonical sequence.
Location on the sequence: help KCLTVGMRLEAVRADRMRGG R NKFGPMYKRDRALKQQKKAQ The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         KCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQ

Mouse                         KCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQ

Rat                           KCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQ

Pig                           KCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQ

Bovine                        KCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQ

Horse                         KCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQ

Baker's yeast                 RCISRNTRL--------------------------------
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 461 Steroidogenic factor 1
Modified residue 72 – 72 N6-acetyllysine



Literature citations
Gonadal determination and adrenal development are regulated by the orphan nuclear receptor steroidogenic factor-1, in a dose-dependent manner.
Achermann J.C.; Ozisik G.; Ito M.; Orun U.A.; Harmanci K.; Gurakan B.; Jameson J.L.;
J. Clin. Endocrinol. Metab. 87:1829-1833(2002)
Cited for: VARIANT SRXY3 GLN-92; Rare causes of primary adrenal insufficiency: genetic and clinical characterization of a large nationwide cohort.
Guran T.; Buonocore F.; Saka N.; Ozbek M.N.; Aycan Z.; Bereket A.; Bas F.; Darcan S.; Bideci A.; Guven A.; Demir K.; Akinci A.; Buyukinan M.; Aydin B.K.; Turan S.; Agladioglu S.Y.; Atay Z.; Abali Z.Y.; Tarim O.; Catli G.; Yuksel B.; Akcay T.; Yildiz M.; Ozen S.; Doger E.; Demirbilek H.; Ucar A.; Isik E.; Ozhan B.; Bolu S.; Ozgen I.T.; Suntharalingham J.P.; Achermann J.C.;
J. Clin. Endocrinol. Metab. 101:284-292(2016)
Cited for: VARIANT AINR GLN-92; NR5A1 is a novel disease gene for 46,XX testicular and ovotesticular disorders of sex development.
Baetens D.; Stoop H.; Peelman F.; Todeschini A.L.; Rosseel T.; Coppieters F.; Veitia R.A.; Looijenga L.H.; De Baere E.; Cools M.;
Genet. Med. 19:367-376(2017)
Cited for: VARIANT SRXX4 TRP-92; CHARACTERIZATION OF VARIANT SRXX4 TRP-92; INVOLVEMENT IN SRXX4; CHARACTERIZATION OF VARIANT SRXY3 GLN-92; SUBCELLULAR LOCATION; A 46,XX ovotesticular disorder of sex development likely caused by a steroidogenic factor-1 (NR5A1) variant.
Swartz J.M.; Ciarlo R.; Guo M.H.; Abrha A.; Weaver B.; Diamond D.A.; Chan Y.M.; Hirschhorn J.N.;
Horm. Res. Paediatr. 87:191-195(2017)
Cited for: INVOLVEMENT IN SRXX4; VARIANT SRXX4 GLN-92;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.