Home  |  Contact

UniProtKB/Swiss-Prot P21802: Variant p.Cys342Gly

Fibroblast growth factor receptor 2
Gene: FGFR2
Variant information

Variant position:  342
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LP/P [Disclaimer]
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Cysteine (C) to Glycine (G) at position 342 (C342G, p.Cys342Gly).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (C) to glycine (G)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In PS.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  342
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  821
The length of the canonical sequence.

Location on the sequence:   KEIEVLYIRNVTFEDAGEYT  C LAGNSIGISFHSAWLTVLPA
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         KEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVL----PA

Mouse                         KEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVL--

Chicken                       KEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHTAWLTVL--

Xenopus laevis                EEIEVLYVRNVSFEDAGEYTCIAGNSIGISQHSAWLTVH--

Zebrafish                     KEIEVLYLPNVTFEDAGEYTCLAGNSIGISYHTAWLTVH--

Drosophila                    DSV-VLTLRNVTFDQEGWYTCLASSGLGRSNSSVYLRVVSP

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 22 – 821 Fibroblast growth factor receptor 2
Topological domain 22 – 377 Extracellular
Domain 256 – 358 Ig-like C2-type 3
Glycosylation 331 – 331 N-linked (GlcNAc...) asparagine
Disulfide bond 278 – 342
Alternative sequence 250 – 361 Missing. In isoform 17.
Alternative sequence 255 – 821 Missing. In isoform 8.
Alternative sequence 314 – 429 Missing. In isoform 9.
Alternative sequence 341 – 353 TCLAGNSIGISFH -> ICKVSNYIGQANQ. In isoform 3, isoform 4, isoform 11, isoform 12, isoform 13 and isoform 16.
Alternative sequence 361 – 361 P -> PKQQ. In isoform 3, isoform 4, isoform 11, isoform 12, isoform 13 and isoform 16.
Beta strand 338 – 346


Literature citations

Analysis of the mutational spectrum of the FGFR2 gene in Pfeiffer syndrome.
Cornejo-Roldan L.R.; Roessler E.; Muenke M.;
Hum. Genet. 104:425-431(1999)
Cited for: VARIANTS PS CYS-340 AND GLY-342;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.