Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P14136: Variant p.Arg416Trp

Glial fibrillary acidic protein
Gene: GFAP
Feedback?
Variant information Variant position: help 416 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Tryptophan (W) at position 416 (R416W, p.Arg416Trp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to large size and aromatic (W) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In ALXDRD. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 416 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 432 The length of the canonical sequence.
Location on the sequence: help TKSVSEGHLKRNIVVKTVEM R DGEVIKESKQEHKDVM The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 432 Glial fibrillary acidic protein
Region 378 – 432 Tail
Modified residue 406 – 406 Citrulline
Modified residue 416 – 416 Citrulline
Alternative sequence 391 – 432 ETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM -> GGKSTKDGENHKVTRYLKSLTIRVIPIQAHQIVNGTPPARG. In isoform 2.
Alternative sequence 391 – 432 ETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM -> GQYSRASWEGHWSPAPSSRACRLLQTGTEDQGKGIQLSLGAFVTLQRS. In isoform 3.



Literature citations
Mutations in GFAP, encoding glial fibrillary acidic protein, are associated with Alexander disease.
Brenner M.; Johnson A.B.; Boespflug-Tanguy O.; Rodriguez D.; Goldman J.E.; Messing A.;
Nat. Genet. 27:117-120(2001)
Cited for: INVOLVEMENT IN ALXDRD; VARIANTS ALXDRD CYS-79; HIS-79; CYS-239; HIS-239; PRO-258 AND TRP-416; VARIANTS LEU-47 AND ASN-295;
Molecular findings in symptomatic and pre-symptomatic Alexander disease patients.
Gorospe J.R.; Naidu S.; Johnson A.B.; Puri V.; Raymond G.V.; Jenkins S.D.; Pedersen R.C.; Lewis D.; Knowles P.; Fernandez R.; De Vivo D.; van der Knaap M.S.; Messing A.; Brenner M.; Hoffman E.P.;
Neurology 58:1494-1500(2002)
Cited for: VARIANTS ALXDRD ARG-73; GLY-79; CYS-79; HIS-79; CYS-88; CYS-239; ASP-242; LYS-373 AND TRP-416;
Glial fibrillary acidic protein mutations in infantile, juvenile, and adult forms of Alexander disease.
Li R.; Johnson A.B.; Salomons G.; Goldman J.E.; Naidu S.; Quinlan R.; Cree B.; Ruyle S.Z.; Banwell B.; D'Hooghe M.; Siebert J.R.; Rolf C.M.; Cox H.; Reddy A.; Gutierrez-Solana L.G.; Collins A.; Weller R.O.; Messing A.; van der Knaap M.S.; Brenner M.;
Ann. Neurol. 57:310-326(2005)
Cited for: VARIANTS LEU-47; ILE-115; ASN-157 AND GLN-223; VARIANTS ALXDRD GLN-63; THR-73; PHE-76; VAL-76; SER-77; CYS-79; CYS-88; PRO-97; LYS-207; GLN-207; LYS-210; PRO-235; CYS-239; HIS-239; PRO-239; VAL-244; GLY-253; GLU-279; PRO-352; VAL-359; PRO-364; HIS-366; LYS-373; GLN-373; GLY-374 AND TRP-416; CHARACTERIZATION OF VARIANTS ALXDRD GLN-63; LYS-210; VAL-244 AND GLY-253; CHARACTERIZATION OF VARIANT ILE-115;
GFAP mutations and polymorphisms in 13 unrelated Italian patients affected by Alexander disease.
Caroli F.; Biancheri R.; Seri M.; Rossi A.; Pessagno A.; Bugiani M.; Corsolini F.; Savasta S.; Romano S.; Antonelli C.; Romano A.; Pareyson D.; Gambero P.; Uziel G.; Ravazzolo R.; Ceccherini I.; Filocamo M.;
Clin. Genet. 72:427-433(2007)
Cited for: VARIANTS ALXDRD TRP-70; GLN-70; LYS-73; SER-77; CYS-79; PRO-79; CYS-88; HIS-239; PRO-239; PRO-359 AND TRP-416;
Diagnosis by whole exome sequencing of atypical infantile onset Alexander disease masquerading as a mitochondrial disorder.
Nishri D.; Edvardson S.; Lev D.; Leshinsky-Silver E.; Ben-Sira L.; Henneke M.; Lerman-Sagie T.; Blumkin L.;
Eur. J. Paediatr. Neurol. 18:495-501(2014)
Cited for: VARIANT ALXDRD TRP-416;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.