Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9ULV5: Variant p.Ala19Asp

Heat shock factor protein 4
Gene: HSF4
Feedback?
Variant information Variant position: help 19 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Alanine (A) to Aspartate (D) at position 19 (A19D, p.Ala19Asp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from small size and hydrophobic (A) to medium size and acidic (D) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In CTRCT5; sporadic; decreased binding to the DNASE2B promoter and decreased DNASE2B expression; impaired RAD51 induction and UVC-induced DNA damage repair. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 19 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 492 The length of the canonical sequence.
Location on the sequence: help MQEAPAALPTEPGPSPVP A FLGKLWALVGDPGTDHLIRW The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         MQEAPAALPTEPG-PSPVPAFLGKLWALVGDPGTDHLIRW

                              MQEAPAALPTEPG-PSPVPAFLGKLWALVGDPGTDHLIR

Mouse                         MQEAPAALPTEPG-PSPVPAFLGKLWALVGDPGTDHLIR

Zebrafish                     MQENPGSIGVDGGYASNVPAFLTKLWTLVEDPETNHLIC
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 492 Heat shock factor protein 4
DNA binding 17 – 121
Helix 19 – 29



Literature citations
HSF4 is involved in DNA damage repair through regulation of Rad51.
Cui X.; Zhang J.; Du R.; Wang L.; Archacki S.; Zhang Y.; Yuan M.; Ke T.; Li H.; Li D.; Li C.; Li D.W.; Tang Z.; Yin Z.; Liu M.;
Biochim. Biophys. Acta 1822:1308-1315(2012)
Cited for: FUNCTION; CHARACTERIZATION OF VARIANTS CTRCT5 ASP-19; VAL-86; PRO-114 AND CYS-119; HSF4 regulates DLAD expression and promotes lens de-nucleation.
Cui X.; Wang L.; Zhang J.; Du R.; Liao S.; Li D.; Li C.; Ke T.; Li D.W.; Huang H.; Yin Z.; Tang Z.; Liu M.;
Biochim. Biophys. Acta 1832:1167-1172(2013)
Cited for: FUNCTION; CHARACTERIZATION OF VARIANTS CTRCT5 ASP-19; VAL-86; PRO-114 AND CYS-119; Mutant DNA-binding domain of HSF4 is associated with autosomal dominant lamellar and Marner cataract.
Bu L.; Jin Y.; Shi Y.; Chu R.; Ban A.; Eiberg H.; Andres L.; Jiang H.; Zheng G.; Qian M.; Cui B.; Xia Y.; Liu J.; Hu L.; Zhao G.; Hayden M.R.; Kong X.;
Nat. Genet. 31:276-278(2002)
Cited for: VARIANTS CTRCT5 ASP-19; VAL-86; PRO-114 AND CYS-119; TISSUE SPECIFICITY;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.