Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P02458: Variant p.Gly1119Arg

Collagen alpha-1(II) chain
Gene: COL2A1
Feedback?
Variant information Variant position: help 1119 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Glycine (G) to Arginine (R) at position 1119 (G1119R, p.Gly1119Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In ACG2. Any additional useful information about the variant.


Sequence information Variant position: help 1119 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1487 The length of the canonical sequence.
Location on the sequence: help PSGPAGARGIQGPQGPRGDK G EAGEPGERGLKGHRGFTGLQ The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         PSGPAGARGIQGPQGPRGDKGEAGEPGERGLKGHRGFTGLQ

Mouse                         PSGPAGARGIAGPQGPRGDKGESGEQGERGLKGHRGFTGLQ

Rat                           PSGPAGARGIAGPQGPRGDKGEAGEPGERGLKGHRGFTGLQ

Bovine                        PAGPAGARGMPGPQGPRGDKGETGEAGERGLKGHRGFTGLQ

Xenopus laevis                PSGPAGARGLAGPQGPRGDKGEAGEAGERGQKGHRGFTGLQ

Xenopus tropicalis            PSGPAGARGLPGPQGPRGDKGEAGEAGERGQKGHRGFTGLQ

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 182 – 1241 Collagen alpha-1(II) chain
Region 97 – 1237 Disordered
Region 201 – 1214 Triple-helical region
Compositional bias 1115 – 1129 Basic and acidic residues
Modified residue 1130 – 1130 5-hydroxylysine
Glycosylation 1130 – 1130 O-linked (Gal...) hydroxylysine
Alternative sequence 1 – 1219 Missing. In isoform 3.
Helix 1118 – 1121



Literature citations
Widely distributed mutations in the COL2A1 gene produce achondrogenesis type II/hypochondrogenesis.
Koerkkoe J.; Cohn D.H.; Ala-Kokko L.; Krakow D.; Prockop D.J.;
Am. J. Med. Genet. 92:95-100(2000)
Cited for: VARIANTS ACG2 VAL-453; ASP-453; ASP-771; ARG-780; ARG-795; GLU-894; ASP-948; SER-981; VAL-1065 AND ARG-1119; VARIANT HYPOCHONDROGENESIS 1017-GLY--VAL-1022 DEL; VARIANT ILE-1331;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.