Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q14524: Variant p.Gly514Cys

Sodium channel protein type 5 subunit alpha
Gene: SCN5A
Feedback?
Variant information Variant position: help 514 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Glycine (G) to Cysteine (C) at position 514 (G514C, p.Gly514Cys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to medium size and polar (C) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In BRGDA1 and PFHB1A. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 514 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 2016 The length of the canonical sequence.
Location on the sequence: help LPKSDSEDGPRAMNHLSLTR G LSRTSMKPRSSRGSIFTFRR The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         LPKSDSEDGPRAMNHLSLTRGLSRTSMKPRSSRGSIFTFRR

Mouse                         LPKSDSEDGPRALNQLSLTHGLSRTSMRPRSSRGSIFTFRR

Rat                           LPKSDSEDGPRALNQLSLTHGLSRTSMRPRSSRGSIFTFRR
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 2016 Sodium channel protein type 5 subunit alpha
Topological domain 414 – 719 Cytoplasmic
Region 461 – 591 Disordered
Compositional bias 509 – 528 Polar residues
Modified residue 497 – 497 Phosphoserine
Modified residue 510 – 510 Phosphoserine
Modified residue 513 – 513 Dimethylated arginine; alternate
Modified residue 513 – 513 Omega-N-methylarginine; alternate
Modified residue 526 – 526 Dimethylated arginine; alternate
Modified residue 526 – 526 Omega-N-methylarginine; alternate



Literature citations
A sodium-channel mutation causes isolated cardiac conduction disease.
Tan H.L.; Bink-Boelkens M.T.E.; Bezzina C.R.; Viswanathan P.C.; Beaufort-Krol G.C.M.; van Tintelen P.J.; van den Berg M.P.; Wilde A.A.M.; Balser J.R.;
Nature 409:1043-1047(2001)
Cited for: CHARACTERIZATION OF VARIANT PFHB1A CYS-514; FUNCTION; TRANSPORTER ACTIVITY; Type of SCN5A mutation determines clinical severity and degree of conduction slowing in loss-of-function sodium channelopathies.
Meregalli P.G.; Tan H.L.; Probst V.; Koopmann T.T.; Tanck M.W.; Bhuiyan Z.A.; Sacher F.; Kyndt F.; Schott J.-J.; Albuisson J.; Mabo P.; Bezzina C.R.; Le Marec H.; Wilde A.A.M.;
Heart Rhythm 6:341-348(2009)
Cited for: VARIANTS BRGDA1 LYS-161; CYS-367; HIS-367; CYS-514; ARG-752; TRP-1232; ASN-1275; VAL-1319; ARG-1408; TRP-1512; GLY-1714; ARG-1740; GLU-1743 AND THR-1924; VARIANTS PFHB1A LYS-161; CYS-367; HIS-367; CYS-514; ARG-752; TRP-1232; ASN-1275; VAL-1319; ARG-1408; TRP-1512; GLY-1714; ARG-1740; GLU-1743 AND THR-1924;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.