Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q14524: Variant p.Asp1595Asn

Sodium channel protein type 5 subunit alpha
Gene: SCN5A
Feedback?
Variant information Variant position: help 1595 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Aspartate (D) to Asparagine (N) at position 1595 (D1595N, p.Asp1595Asn). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and acidic (D) to medium size and polar (N) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In PFHB1A; significant defect in the kinetics of fast-channel inactivation distinct from mutations reported in LQT3. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 1595 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 2016 The length of the canonical sequence.
Location on the sequence: help CIVKLAALRHYYFTNSWNIF D FVVVILSIVGTVLSDIIQKY The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         CIVKLAALRHYYFTNSWNIFDFVVVILSIVGTVLSDIIQKY

Mouse                         CIVKMAALRHYYFTNSWNIFDFVVVILSIVGTVLSDIIQKY

Rat                           CIVKMAALRHYYFTNSWNIFDFVVVILSIVGTVLSDIIQKY
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 2016 Sodium channel protein type 5 subunit alpha
Transmembrane 1590 – 1612 Helical; Name=S3 of repeat IV
Repeat 1510 – 1807 IV
Alternative sequence 1573 – 1604 Missing. In isoform 3.
Mutagenesis 1610 – 1610 D -> A. Complete loss of channel inhibition by the spider Jingzhaotoxin-I.
Mutagenesis 1610 – 1610 D -> R. High decrease in affinity to the sea anemone toxin anthopleurin-B.
Mutagenesis 1614 – 1614 K -> A. 4.2-fold decrease of channel inhibition potency by the spider Jingzhaotoxin-I.
Helix 1592 – 1608



Literature citations
Clinical, genetic and biophysical characterisation of SCN5A mutations associated with atrioventricular conduction block.
Wang D.W.; Viswanathan P.C.; Balser J.R.; George A.L. Jr.; Benson D.W.;
Circulation 105:341-346(2002)
Cited for: CHARACTERIZATION OF VARIANTS PFHB1A SER-298 AND ASN-1595; FUNCTION; TRANSPORTER ACTIVITY;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.