Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q8TD31: Variant p.Arg102Gln

Coiled-coil alpha-helical rod protein 1
Gene: CCHCR1
Feedback?
Variant information Variant position: help 102 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Glutamine (Q) at position 102 (R102Q, p.Arg102Gln). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to medium size and polar (Q) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism: help HCR*WWCC is associated with susceptibility to psoriasis. Psoriasis is a chronic inflammatory dermatosis that affects approximately 2% of the population. It is a multifactorial disease characterized by red, scaly skin lesions that are usually found on the scalp, elbows, and knees, and may be associated with severe arthritis. The lesions are caused by hyperproliferative keratinocytes and infiltration of inflammatory cells into the dermis and epidermis. The usual age of onset of psoriasis is between 15 and 30 years, although it can present at any age. Association of HCR with psoriasis seem to be due to linkage disequilibrium with Cw*06:02 (PubMed:11348465). HCR is unlikely to be directly involved in psoriasis development. Additional information on the polymorphism described.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 102 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 782 The length of the canonical sequence.
Location on the sequence: help EGSQALSQQAEVIVRQLQEL R RLEEEVRLLRETSLQQKMRL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         EGSQALSQQAEVIVRQLQELRRLEEEVRLLRETSLQQKMRL

Gorilla                       EGSQALSQQAEVIARQLQELRRLEEEVRLLRETSLQQKMRL

Chimpanzee                    EGSQALSQQAEVIARQLQELRRLEEEVRLLRETSLQQKMRL

Mouse                         GFSSALSQQAELISRQLQELRRLEEEVRSLRETSLQQKMRL

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 782 Coiled-coil alpha-helical rod protein 1



Literature citations
Coding haplotype analysis supports HCR as the putative susceptibility gene for psoriasis at the MHC PSORS1 locus.
Asumalahti K.; Veal A.; Laitinen T.; Suomela S.; Allen M.; Elomaa O.; Moser M.; de Cid R.; Ripatti S.; Vorechovsky I.; Marcusson J.A.; Nakagawa H.; Lazaro C.; Estivill X.; Capon F.; Novelli G.; Burden D.B.; Tillman D.; Powis S.H.; Balendran N.; Ameen M.; Vaughan R.W.; Heath E.K.; Itkonen-Vatjus R.; Jansen C.; Karvonen J.; Karvonen S.-L.; Kivekas K.; Reunala T.; Snellman E.; Uurasmaa T.; Toftgard R.; Murakami T.; Otsuki M.; Asahina A.; Saeki H.; Barbera E.; Ferrandiz C.; Gimenez Arnau A.; Grimalt F.; Puig S.; Sanchez A.; Palacios A.; Pujol J.A.; Sanchez M.; Simal E.; Vazquez F.; Ramirez B.; Saarialho-Kere U.; Barker J.; Trembath R.; Kere J.;
Hum. Mol. Genet. 11:589-597(2002)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); VARIANTS GLN-102; TRP-103; TRP-109; ARG-164; ASP-275; TRP-417; CYS-575; GLN-627; HIS-639 AND CYS-776;
The HCR gene on 6p21 is unlikely to be a psoriasis susceptibility gene.
O'Brien K.P.; Holm S.J.; Nilsson S.; Carlen L.; Rosenmuller T.; Enerbaeck C.; Inerot A.; Staahle-Baeckdahl M.;
J. Invest. Dermatol. 116:750-754(2001)
Cited for: VARIANTS GLN-102; TRP-103; TRP-109; ARG-164; GLN-179; ASP-275; THR-367; TRP-417; GLN-417; CYS-575; GLN-627; VAL-733 AND CYS-776;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.