Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P35499: Variant p.Arg672His

Sodium channel protein type 4 subunit alpha
Gene: SCN4A
Feedback?
Variant information Variant position: help 672 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Arginine (R) to Histidine (H) at position 672 (R672H, p.Arg672His). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to medium size and polar (H) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In HOKPP2. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 672 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1836 The length of the canonical sequence.
Location on the sequence: help LSLVELGLANVQGLSVLRSF R LLRVFKLAKSWPTLNMLIKI The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         LSLVELGLANVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKI

Mouse                         LSLVELGLANVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKI

Rat                           LSLVELGLANVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKI

Horse                         LSWVELGLVNVKGLSVLRSFRLVRSLKLAKSWPTLNMFIRI
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 1836 Sodium channel protein type 4 subunit alpha
Transmembrane 665 – 682 Helical; Name=S4 of repeat II
Repeat 560 – 832 II
Helix 672 – 680



Literature citations
Voltage-sensor sodium channel mutations cause hypokalemic periodic paralysis type 2 by enhanced inactivation and reduced current.
Jurkat-Rott K.; Mitrovic N.; Hang C.; Kouzmekine A.; Iaizzo P.; Herzog J.; Lerche H.; Nicole S.; Vale-Santos J.; Chauveau D.; Fontaine B.; Lehmann-Horn F.;
Proc. Natl. Acad. Sci. U.S.A. 97:9549-9554(2000)
Cited for: VARIANTS HOKPP2 GLY-672 AND HIS-672; Voltage sensor charge loss accounts for most cases of hypokalemic periodic paralysis.
Matthews E.; Labrum R.; Sweeney M.G.; Sud R.; Haworth A.; Chinnery P.F.; Meola G.; Schorge S.; Kullmann D.M.; Davis M.B.; Hanna M.G.;
Neurology 72:1544-1547(2009)
Cited for: VARIANTS HOKPP2 TRP-222; CYS-672; GLY-672; HIS-672; SER-672; GLN-1132 AND HIS-1135; Hypokalemic periodic paralysis due to the SCN4A R672H mutation in a Turkish family.
Incecik F.; Herguner M.O.; Altunbasak S.; Lehman-Horn F.;
Turk. J. Pediatr. 52:409-410(2010)
Cited for: VARIANT HOKPP2 HIS-672;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.