UniProtKB/Swiss-Prot Q13426 : Variant p.Gln240Pro
DNA repair protein XRCC4
Gene: XRCC4
Feedback ?
Variant information
Variant position:
240
The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:
LB/B
The variants are classified into three categories: LP/P, LB/B and US.LP/P: likely pathogenic or pathogenic. LB/B: likely benign or benign. US: uncertain significance
Residue change:
From Glutamine (Q) to Proline (P) at position 240 (Q240P, p.Gln240Pro).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:
Change from medium size and polar (Q) to medium size and hydrophobic (P)
The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:
-1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another: Lowest score: -4 (low probability of substitution).Highest score: 11 (high probability of substitution). More information can be found on the following page
Other resources:
Links to websites of interest for the variant.
Sequence information
Variant position:
240
The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:
336
The length of the canonical sequence.
Location on the sequence:
EMTADRDPVYDESTDEESEN
Q TDLSGLASAAVSKDDSIISS
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:
The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human EMTADRDPVY-----------------DESTDEESENQ TDLSGLASAAVSKDD-----------------------------------------------------------SIISS
Mouse DKTPEEHGLY-----------------DGSTDEESGAP VQ-
Slime mold NKSPSKQQVYTTPKKKKRNYQSNLINIDNDDDDDLGNN DNV
Sequence annotation in neighborhood:
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:Type: the type of sequence feature. Positions: endpoints of the sequence feature. Description: contains additional information about the feature.
Type Positions Description
Chain
1 – 336
DNA repair protein XRCC4
Region
212 – 249
Disordered
Modified residue
229 – 229
Phosphotyrosine
Modified residue
232 – 232
Phosphoserine
Modified residue
233 – 233
Phosphothreonine; by CK2
Modified residue
237 – 237
Phosphoserine
Modified residue
256 – 256
Phosphoserine
Modified residue
260 – 260
Phosphoserine; by PRKDC
Mutagenesis
233 – 233
T -> A. Abolished phosphorylation by CK2, leading to strongly reduced interaction with PNKP.
Mutagenesis
235 – 235
E -> F. Impaired ability mediate double-strand break repair.
Mutagenesis
260 – 260
S -> A. Reduced phosphorylation by PRKDC. In XRCC4-Ala mutant; abolished phosphorylation by PRKDC; does not affect ability to bridge DNA when associated with NHEJ1/XLF phosphorylation-defective mutant; when associated with A-193, A-304, A-315, A-320, A-323, A-327 and A-328.
Mutagenesis
260 – 260
S -> D. In XRCC4-Asp mutant; phospho-mimetic mutant; abolished ability to bridge DNA when associated with NHEJ1/XLF phospho-mimetic mutant; when associated with D-193, D-304, D-315, D-320, D-323, D-327 and D-328.
Literature citations
No reference for the current variant in UniProtKB/Swiss-Prot.
Disclaimer:
Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.