Home  |  Contact

UniProtKB/Swiss-Prot P51798: Variant p.Arg762Gln

H(+)/Cl(-) exchange transporter 7
Gene: CLCN7
Chromosomal location: 16p13
Variant information

Variant position:  762
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Arginine (R) to Glutamine (Q) at position 762 (R762Q, p.Arg762Gln).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to medium size and polar (Q)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Osteopetrosis, autosomal dominant 2 (OPTA2) [MIM:166600]: A rare genetic disease characterized by abnormally dense bone, due to defective resorption of immature bone. Osteopetrosis occurs in two forms: a severe autosomal recessive form occurring in utero, infancy, or childhood, and a benign autosomal dominant form occurring in adolescence or adulthood. OPTA2 is the most common form of osteopetrosis, occurring in adolescence or adulthood. It is characterized by sclerosis, predominantly involving the spine, the pelvis and the skull base. {ECO:0000269|PubMed:11741829, ECO:0000269|PubMed:14584882, ECO:0000269|PubMed:19288050, ECO:0000269|PubMed:19953639, ECO:0000269|PubMed:26395888}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Involvement in disease:  Osteopetrosis, autosomal recessive 4 (OPTB4) [MIM:611490]: A rare genetic disease characterized by abnormally dense bone, due to defective resorption of immature bone. Osteopetrosis occurs in two forms: a severe autosomal recessive form occurring in utero, infancy, or childhood, and a benign autosomal dominant form occurring in adolescence or adulthood. Recessive osteopetrosis commonly manifests in early infancy with macrocephaly, feeding difficulties, evolving blindness and deafness, bone marrow failure, severe anemia, and hepatosplenomegaly. Deafness and blindness are generally thought to represent effects of pressure on nerves. {ECO:0000269|PubMed:11207362, ECO:0000269|PubMed:11741829, ECO:0000269|PubMed:14584882, ECO:0000269|PubMed:17033731, ECO:0000269|PubMed:19953639, ECO:0000269|PubMed:26477479}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In OPTA2 and OPTB4; not detected in the fibroblasts from the patient.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  762
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  805
The length of the canonical sequence.

Location on the sequence:   NPSPYTVPQEASLPRVFKLF  R ALGLRHLVVVDNRNQVVGLV
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         NPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNRNQVVGLV

Mouse                         NPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNHNQVVGLV

Rat                           NPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNHNQVVGLV

Bovine                        NPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNCNQVVGLV

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 805 H(+)/Cl(-) exchange transporter 7
Topological domain 598 – 805 Cytoplasmic
Domain 741 – 799 CBS 2


Literature citations

Loss of the ClC-7 chloride channel leads to osteopetrosis in mice and man.
Kornak U.; Kasper D.; Boesl M.R.; Kaiser E.; Schweizer M.; Schulz A.; Friedrich W.; Delling G.; Jentsch T.J.;
Cell 104:205-215(2001)
Cited for: VARIANT OPTB4 GLN-762;

Molecular and clinical heterogeneity in CLCN7-dependent osteopetrosis: report of 20 novel mutations.
Pangrazio A.; Pusch M.; Caldana E.; Frattini A.; Lanino E.; Tamhankar P.M.; Phadke S.; Lopez A.G.; Orchard P.; Mihci E.; Abinun M.; Wright M.; Vettenranta K.; Bariae I.; Melis D.; Tezcan I.; Baumann C.; Locatelli F.; Zecca M.; Horwitz E.; Mansour L.S.; Van Roij M.; Vezzoni P.; Villa A.; Sobacchi C.;
Hum. Mutat. 31:E1071-E1080(2010)
Cited for: VARIANTS OPTB4 PRO-132; SER-214; LEU-227 DEL; ARG-240; GLN-403; ARG-521; GLN-526; TRP-526; PRO-549; PRO-651; TRP-762 AND PRO-767; VARIANTS OPTA2 ARG-215; GLN-286; LEU-318; LEU-758; GLN-762 AND TRP-767;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.