UniProtKB/SwissProt variant VAR

Variant information

Variant position:

250

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:

LP/P [Disclaimer]

The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Serine (S) to Arginine (R) at position 250 (S250R, p.Ser250Arg).

Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:

Change from small size and polar (S) to large size and basic (R)

The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:

-1

The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Variant description:

In AHO; may alter guanine nucleotide binding which could lead to thermolability and impaired function.

Any additional useful information about the variant.

Other resources:

Links to websites of interest for the variant.

Variant rs137854534 [ dbSNP | Ensembl ]

Sequence information

Variant position:

250

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:

394

The length of the canonical sequence.

Location on the sequence:

ERRKWIQCFNDVTAIIFVVA S SSYNMVIREDNQTNRLQEAL

The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         ERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEAL

Mouse                         ERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEAL

Rat                           ERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEAL

Bovine                        ERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEAL

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	2 – 394	Guanine nucleotide-binding protein G(s) subunit alpha isoforms short
Domain	39 – 394	G-alpha
Mutagenesis	258 – 258	R -> A. Increases GDP release and impairs receptor-mediated activation; markedly elevated intrinsic GTPase rate which will lead to more rapid inactivation.
Helix	250 – 254

Literature citations

A novel mutation adjacent to the switch III domain of G(S alpha) in a patient with pseudohypoparathyroidism.
Warner D.R.; Gejman P.V.; Collins R.M.; Weinstein L.S.;
Mol. Endocrinol. 11:1718-1727(1997)
Cited for: VARIANT AHO ARG-250;

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P63092: Variant p.Ser250Arg