UniProtKB/Swiss-Prot P39060: Variant p.Pro1121Arg

Collagen alpha-1(XVIII) chain
Gene: COL18A1
Feedback?

Variant information Variant position:

1121 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Proline (P) to Arginine (R) at position 1121 (P1121R, p.Pro1121Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and hydrophobic (P) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Polymorphism:

There is an association between a polymorphism in position 1675 and prostate cancer. Heterozygous Asn-1675 individuals have a 2.5 times increased chance of developing prostate cancer as compared with homozygous Asp-1675 individuals. Additional information on the polymorphism described.
Other resources:

Links to websites of interest for the variant.

Variant rs79980197 [ dbSNP | Ensembl ]

Sequence information Variant position:

1121 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

1754 The length of the canonical sequence.
Location on the sequence:

RGEKGDPGKDGVGQPGLPGP P GPPGPVVYVSEQDGSVLSVP The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         RGEKGDPGKDGVGQPGLPGPPGPPGPVVYVSEQDGSVLSVP

Mouse                         PGEKGNPGKDGVGRPGLPGPPGPPGPVIYVSSEDKAIVSTP

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	24 – 1754	Collagen alpha-1(XVIII) chain
Region	645 – 1443	Disordered
Region	1045 – 1127	Triple-helical region 4 (COL4)

Literature citations
Cloning of cDNA and genomic DNA encoding human type XVIII collagen and localization of the alpha 1(XVIII) collagen gene to mouse chromosome 10 and human chromosome 21.
Oh S.P.; Warman M.L.; Seldin M.F.; Cheng S.; Knoll J.H.; Timmons S.; Olsen B.R.;
Genomics 19:494-499(1994)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1069-1754; VARIANT ARG-1121; Knobloch syndrome: novel mutations in COL18A1, evidence for genetic heterogeneity, and a functionally impaired polymorphism in endostatin.
Menzel O.; Bekkeheien R.C.J.; Reymond A.; Fukai N.; Boye E.; Kosztolanyi G.; Aftimos S.; Deutsch S.; Scott H.S.; Olsen B.R.; Antonarakis S.E.; Guipponi M.;
Hum. Mutat. 23:77-84(2004)
Cited for: VARIANTS LEU-49; ARG-111; ILE-1076 AND ARG-1121; CHARACTERIZATION OF VARIANT ASN-1675; DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome.
Ley T.J.; Mardis E.R.; Ding L.; Fulton B.; McLellan M.D.; Chen K.; Dooling D.; Dunford-Shore B.H.; McGrath S.; Hickenbotham M.; Cook L.; Abbott R.; Larson D.E.; Koboldt D.C.; Pohl C.; Smith S.; Hawkins A.; Abbott S.; Locke D.; Hillier L.W.; Miner T.; Fulton L.; Magrini V.; Wylie T.; Glasscock J.; Conyers J.; Sander N.; Shi X.; Osborne J.R.; Minx P.; Gordon D.; Chinwalla A.; Zhao Y.; Ries R.E.; Payton J.E.; Westervelt P.; Tomasson M.H.; Watson M.; Baty J.; Ivanovich J.; Heath S.; Shannon W.D.; Nagarajan R.; Walter M.J.; Link D.C.; Graubert T.A.; DiPersio J.F.; Wilson R.K.;
Nature 456:66-72(2008)
Cited for: VARIANT [LARGE SCALE ANALYSIS] ARG-1121;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.