UniProtKB/Swiss-Prot Q9NQW8: Variant p.Cys234Trp

Cyclic nucleotide-gated channel beta-3
Gene: CNGB3
Feedback?

Variant information Variant position:

234 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Cysteine (C) to Tryptophan (W) at position 234 (C234W, p.Cys234Trp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and polar (C) to large size and aromatic (W) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs6471482 [ dbSNP | Ensembl ]

Sequence information Variant position:

234 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

809 The length of the canonical sequence.
Location on the sequence:

TDRLYLLWLLLVTLAYNWNC C FIPLRLVFPYQTADNIHYWL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         TDRLYLLWLLLVTLAYNWNCCFIPLRLVFPYQTADNIHYWL

                              TDRLYLLWLLLVTIAYNWNCWLIPLRLVFPYQTPDNTHYWF

Mouse                         TDRVYLLWLLLVTIAYNWNCWLLPVRLVFPCQTPDNKNYWI

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 809	Cyclic nucleotide-gated channel beta-3
Transmembrane	219 – 242	Helical; Name=S1
Helix	216 – 241

Literature citations
Mutations in the CNGB3 gene encoding the beta-subunit of the cone photoreceptor cGMP-gated channel are responsible for achromatopsia (ACHM3) linked to chromosome 8Q21.
Kohl S.; Baumann B.; Broghammer M.; Jaegle H.; Sieving P.; Kellner U.; Spegal R.; Anastasi M.; Zrenner E.; Sharpe L.T.; Wissinger B.;
Hum. Mol. Genet. 9:2107-2116(2000)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); TISSUE SPECIFICITY; VARIANT ACHM3 PHE-435; VARIANTS TRP-234; PRO-298 AND GLY-755;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.