Home  |  Contact

UniProtKB/Swiss-Prot Q9NQW8: Variant p.Thr298Pro

Cyclic nucleotide-gated cation channel beta-3
Gene: CNGB3
Variant information

Variant position:  298
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LB/B
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Threonine (T) to Proline (P) at position 298 (T298P, p.Thr298Pro).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (T) to medium size and hydrophobic (P)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  298
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  809
The length of the canonical sequence.

Location on the sequence:   VRGGDIIVDSNELRKHYRTS  T KFQLDVASIIPFDICYLFFG
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         VRGGDIIVDSNELRKHYRTSTKFQLDVASIIPFDICYLFFG

                              IKGGDIMVDSNELKRHYRSSTKFQLDVASVMPFDVFYLFFG

Mouse                         VRGGEIIVDSNELKRNYRSSTKFRMDVASLLPFEVLYIFFG

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 809 Cyclic nucleotide-gated cation channel beta-3
Topological domain 272 – 302 Cytoplasmic


Literature citations

Mutations in the CNGB3 gene encoding the beta-subunit of the cone photoreceptor cGMP-gated channel are responsible for achromatopsia (ACHM3) linked to chromosome 8Q21.
Kohl S.; Baumann B.; Broghammer M.; Jaegle H.; Sieving P.; Kellner U.; Spegal R.; Anastasi M.; Zrenner E.; Sharpe L.T.; Wissinger B.;
Hum. Mol. Genet. 9:2107-2116(2000)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); TISSUE SPECIFICITY; VARIANT ACHM3 PHE-435; VARIANTS TRP-234; PRO-298 AND GLY-755;

Cone cGMP-gated channel mutations and clinical findings in patients with achromatopsia, macular degeneration, and other hereditary cone diseases.
Nishiguchi K.M.; Sandberg M.A.; Gorji N.; Berson E.L.; Dryja T.P.;
Hum. Mutat. 25:248-258(2005)
Cited for: VARIANT MACULAR DEGENERATION GLN-403; VARIANT STGD1 ASP-469; VARIANTS ACHM3 ARG-107; LYS-199; THR-466; ASN-494; TYR-513; CYS-558; PHE-595 AND PRO-672; VARIANTS HIS-25; SER-27; GLN-203; PRO-298; VAL-307 AND GLY-755;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.