Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P51810: Variant p.Gly229Val

G-protein coupled receptor 143
Gene: GPR143
Feedback?
Variant information Variant position: help 229 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Glycine (G) to Valine (V) at position 229 (G229V, p.Gly229Val). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to medium size and hydrophobic (V) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In OA1; not delivered at the cell surface of melanocytic and non-melanocytic cells. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 229 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 404 The length of the canonical sequence.
Location on the sequence: help NPILFQKTVTAVASLLKGRQ G IYTENERRMGAVIKIRFFKI The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         NPILFQKTVTAVASLLKGRQGIYTENERRMGAVIKIRFFKI

Mouse                         NPILFHKTVTSVASLLKGRKGVYTENERLMGAVIKTRFFKI
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 404 G-protein coupled receptor 143
Topological domain 213 – 248 Cytoplasmic
Region 221 – 238 Necessary for its G protein-activation ability and normal distribution of melanosomes
Motif 222 – 231 lysosomal/melanosomal membrane localization signal



Literature citations
An unconventional dileucine-based motif and a novel cytosolic motif are required for the lysosomal and melanosomal targeting of OA1.
Piccirillo R.; Palmisano I.; Innamorati G.; Bagnato P.; Altimare D.; Schiaffino M.V.;
J. Cell Sci. 119:2003-2014(2006)
Cited for: SUBCELLULAR LOCATION; CHARACTERIZATION OF VARIANTS OA1 VAL-229; LYS-232; LYS-235 AND VAL-244; MUTAGENESIS OF 224-LEU-LEU-225 AND 329-LEU-LEU-330; Diverse prevalence of large deletions within the OA1 gene in ocular albinism type 1 patients from Europe and North America.
Bassi M.T.; Bergen A.A.; Bitoun P.; Charles S.J.; Clementi M.; Gosselin R.; Hurst J.; Lewis R.A.; Lorenz B.; Meitinger T.; Messiaen L.; Ramesar R.S.; Ballabio A.; Schiaffino M.V.;
Hum. Genet. 108:51-54(2001)
Cited for: VARIANTS OA1 CYS-5; ASN-78; SER-116; GLU-118; ARG-124; VAL-229; VAL-244; ASN-261; GLY-271 AND CYS-292;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.