UniProtKB/Swiss-Prot Q8IUX4: Variant p.Gln61Leu

• Variant information
• Sequence information
• Literature citations
• All

Variant information

Variant position: 61 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: LB/B The variants are classified into three categories: LP/P, LB/B and US.

• LP/P: likely pathogenic or pathogenic.
• LB/B: likely benign or benign.
• US: uncertain significance

Residue change: From Glutamine (Q) to Leucine (L) at position 61 (Q61L, p.Gln61Leu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: Change from medium size and polar (Q) to medium size and hydrophobic (L) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

• Lowest score: -4 (low probability of substitution).
• Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources: Links to websites of interest for the variant.

• Variant rs2076109 [ dbSNP | Ensembl ]

Sequence information

Variant position: 61 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: 373 The length of the canonical sequence.
Location on the sequence: TKGPSRPRLDAKIFRGQVYS Q PEHHAEMCFLSWFCGNQLPA The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Sequence annotation in neighborhood: The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

• Type: the type of sequence feature.
• Positions: endpoints of the sequence feature.
• Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 373	DNA dC->dU-editing enzyme APOBEC-3F
Domain	29 – 137	CMP/dCMP-type deaminase 1
Binding site	65 – 65
Cross	52 – 52	(Microbial infection) Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Alternative sequence	58 – 79	VYSQPEHHAEMCFLSWFCGNQL -> VPPGLQSLCRQELSQLGKQTTH. In isoform 2.
Alternative sequence	59 – 113	YSQPEHHAEMCFLSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLAEHPNV -> PRSFIRAPFQVLSSPFGQCAPPHGTAQVQWPPQLTAGREQGRP. In isoform 3.
Mutagenesis	65 – 65	H -> C. Reduced but not abolished antiviral activity.
Mutagenesis	65 – 65	H -> R. Nearly abolished antiviral activity; when associated with R-249.
Mutagenesis	67 – 67	E -> A. Decrease in cytidine deaminase and antiviral activity; when associated with A-251.
Mutagenesis	67 – 67	E -> A. No effect on cytidine deaminase and antiviral activity.
Mutagenesis	67 – 67	E -> Q. Reduced but not abolished antiviral activity. Nearly abolished antiviral activity; when associated with Q-251.

Literature citations

No reference for the current variant in UniProtKB/Swiss-Prot.