Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q12948: Variant p.Met161Lys

Forkhead box protein C1
Gene: FOXC1
Feedback?
Variant information Variant position: help 161 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Methionine (M) to Lysine (K) at position 161 (M161K, p.Met161Lys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (M) to large size and basic (K) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In RIEG3 and ASGD3; no change in location at the nucleus; decreased transcription regulatory region DNA binding; decreased sequence-specific DNA binding transcription factor activity. Any additional useful information about the variant.


Sequence information Variant position: help 161 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 553 The length of the canonical sequence.
Location on the sequence: help RDDKKPGKGSYWTLDPDSYN M FENGSFLRRRRRFKKKDAVK The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         RDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAVK

Mouse                         RDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAVK

Xenopus tropicalis            RDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVVK

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 553 Forkhead box protein C1
DNA binding 77 – 168 Fork-head



Literature citations
Mutation spectrum of FOXC1 and clinical genetic heterogeneity of Axenfeld-Rieger anomaly in India.
Komatireddy S.; Chakrabarti S.; Mandal A.K.; Reddy A.B.M.; Sampath S.; Panicker S.G.; Balasubramanian D.;
Mol. Vis. 9:43-48(2003)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANT RIEG3 LYS-161; Novel mutation in FOXC1 wing region causing Axenfeld-Rieger anomaly.
Panicker S.G.; Sampath S.; Mandal A.K.; Reddy A.B.M.; Ahmed N.; Hasnain S.E.;
Invest. Ophthalmol. Vis. Sci. 43:3613-3616(2002)
Cited for: VARIANT RIEG3 LYS-161; The wing 2 region of the FOXC1 forkhead domain is necessary for normal DNA-binding and transactivation functions.
Murphy T.C.; Saleem R.A.; Footz T.; Ritch R.; McGillivray B.; Walter M.A.;
Invest. Ophthalmol. Vis. Sci. 45:2531-2538(2004)
Cited for: VARIANTS RIEG3 ARG-165 AND PRO-169; CHARACTERIZATION OF VARIANTS RIEG3 LYS-161; ARG-165 AND PRO-169; FUNCTION; SUBCELLULAR LOCATION; Heterozygous FOXC1 mutation (M161K) associated with congenital glaucoma and aniridia in an infant and a milder phenotype in her mother.
Khan A.O.; Aldahmesh M.A.; Al-Amri A.;
Ophthalmic Genet. 29:67-71(2008)
Cited for: VARIANT ASGD3 LYS-161;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.