Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q13496: Variant p.Leu391Pro

Myotubularin
Gene: MTM1
Feedback?
Variant information Variant position: help 391 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Leucine (L) to Proline (P) at position 391 (L391P, p.Leu391Pro). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In CNMX. Any additional useful information about the variant.


Sequence information Variant position: help 391 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 603 The length of the canonical sequence.
Location on the sequence: help VLVHCSDGWDRTAQLTSLAM L MLDSFYRSIEGFEILVQKEW The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         VLVHCSDGWDRTAQLTSLAMLMLDSFYRSIEGFEILVQKEW

Mouse                         VLVHCSDGWDRTAQLTSLAMLMLDSFYRTIEGFEILVQKEW

Rat                           VLVHCSDGWDRTAQLTTLAMLMLDGFYRSIEGFEILVQKEW

Bovine                        VVVHCSDGWDRTAQLTSLAMLMLDSFYRSIEGFEILVQKEW

Xenopus laevis                VVVHCSDGWDRTAQLTSLAMLMLDSYYRTIVGFEVLVQKEW

Xenopus tropicalis            VVVHCSDGWDRTAQLTSLAMLMLDSYYRTIVGFEVLVQKEW

Baker's yeast                 AI--CTHPFDVGKTRWQISMM--------------------
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 603 Myotubularin
Domain 163 – 538 Myotubularin phosphatase
Active site 375 – 375 Phosphocysteine intermediate
Binding site 376 – 376
Binding site 376 – 376
Binding site 377 – 377
Binding site 377 – 377
Binding site 378 – 378
Binding site 378 – 378
Binding site 379 – 379
Binding site 379 – 379
Binding site 380 – 380
Binding site 380 – 380
Binding site 381 – 381
Binding site 381 – 381
Mutagenesis 375 – 375 C -> A. No effect on subcellular location.
Mutagenesis 375 – 375 C -> S. Lacks activity toward PI3P. Does not affect interaction with DES or MTMR12.
Mutagenesis 377 – 377 D -> A. No effect on subcellular location.
Mutagenesis 380 – 380 D -> A. Does not affect interaction with DES.
Mutagenesis 394 – 394 D -> A. Produces an unstable protein.
Mutagenesis 410 – 410 E -> A. Produces an unstable protein.



Literature citations
Characterization of mutations in fifty North American patients with X-linked myotubular myopathy.
Herman G.E.; Kopacz K.; Zhao W.; Mills P.L.; Metzenberg A.; Das S.;
Hum. Mutat. 19:114-121(2002)
Cited for: VARIANTS CNMX PHE-49; CYS-69; SER-179; ILE-186; LEU-205; MET-227; PRO-228; CYS-241; GLY-279; ARG-378; PRO-391; CYS-397; ARG-402 AND GLN-421;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.