Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9H9S5: Variant p.Pro448Leu

Ribitol 5-phosphate transferase FKRP
Gene: FKRP
Feedback?
Variant information Variant position: help 448 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Proline (P) to Leucine (L) at position 448 (P448L, p.Pro448Leu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In MDDGB5; strongly reduced secretion to the medium; localizes mainly to the ER compartment. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 448 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 495 The length of the canonical sequence.
Location on the sequence: help TKDTWLDHRQDVEFPEHFLQ P LVPLPFAGFVAQAPNNYRRF The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         TKDTWLDHRQDVEFPEHFLQPLVPLPFAGFVAQAPNNYRRF

Mouse                         TKDTWLDHRQDVEFPEHFLQPLVPLPFAGFMAQAPNNYRRF
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 495 Ribitol 5-phosphate transferase FKRP
Topological domain 30 – 495 Lumenal
Beta strand 447 – 454



Literature citations
Mutations in the fukutin-related protein gene (FKRP) cause a form of congenital muscular dystrophy with secondary laminin alpha2 deficiency and abnormal glycosylation of alpha-dystroglycan.
Brockington M.; Blake D.J.; Prandini P.; Brown S.C.; Torelli S.; Benson M.A.; Ponting C.P.; Estournet B.; Romero N.B.; Mercuri E.; Voit T.; Sewry C.A.; Guicheney P.; Muntoni F.;
Am. J. Hum. Genet. 69:1198-1209(2001)
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; TISSUE SPECIFICITY; VARIANTS MDDGB5 GLY-114; THR-217; CYS-309; ARG-316; SER-328; HIS-339; ASN-401; LEU-448 AND SER-465; Fukutin-related protein localizes to the Golgi apparatus and mutations lead to mislocalization in muscle in vivo.
Keramaris-Vrantsis E.; Lu P.J.; Doran T.; Zillmer A.; Ashar J.; Esapa C.T.; Benson M.A.; Blake D.J.; Rosenfeld J.; Lu Q.L.;
Muscle Nerve 36:455-465(2007)
Cited for: SUBCELLULAR LOCATION; CHARACTERIZATION OF VARIANTS ILE-276 AND LEU-448; Mutations alter secretion of fukutin-related protein.
Lu P.J.; Zillmer A.; Wu X.; Lochmuller H.; Vachris J.; Blake D.; Chan Y.M.; Lu Q.L.;
Biochim. Biophys. Acta 1802:253-258(2010)
Cited for: SUBCELLULAR LOCATION; GLYCOSYLATION; CHARACTERIZATION OF VARIANTS ILE-276 AND LEU-448; Phenotypic spectrum associated with mutations in the fukutin-related protein gene.
Mercuri E.; Brockington M.; Straub V.; Quijano-Roy S.; Yuva Y.; Herrmann R.; Brown S.C.; Torelli S.; Dubowitz V.; Blake D.J.; Romero N.B.; Estournet B.; Sewry C.A.; Guicheney P.; Voit T.; Muntoni F.;
Ann. Neurol. 53:537-542(2003)
Cited for: VARIANTS MDDGB5 CYS-309; HIS-339 AND LEU-448; VARIANTS MDDGC5 ILE-276; ASN-307; SER-316; ASN-360 AND SER-462;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.