UniProtKB/Swiss-Prot P16422: Variant p.Met115Thr

Epithelial cell adhesion molecule
Gene: EPCAM
Feedback?

Variant information Variant position:

115 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Methionine (M) to Threonine (T) at position 115 (M115T, p.Met115Thr). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and hydrophobic (M) to medium size and polar (T) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs1126497 [ dbSNP | Ensembl ]

Sequence information Variant position:

115 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

314 The length of the canonical sequence.
Location on the sequence:

YDPDCDESGLFKAKQCNGTS M CWCVNTAGVRRTDKDTEITC The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         YDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDK-DTEITC

Rhesus macaque                YDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDK-DTEIT

Mouse                         YDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDK-DTEIT

Rat                           YDPECDEQGLFKAKQCNGTATCWCVNTAGVRRTDK-DTEIT

Pig                           YDPDCDENGLFKAKQCNGTSMCWCVNTAGVRRTDK-DSEIS

Bovine                        YDPECDDKGLFKAKQCNGTSTCWCVNTAGVRRTDK-DSEIS

Chicken                       YDPECENNGLFKAKQCNGT-TCWCVNTAGVRRTDKHDTDLK

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	24 – 314	Epithelial cell adhesion molecule
Topological domain	24 – 265	Extracellular
Domain	63 – 135	Thyroglobulin type-1
Glycosylation	111 – 111	N-linked (GlcNAc...) asparagine
Disulfide bond	110 – 116
Mutagenesis	111 – 111	N -> A. Changed glycosylation pattern. Complete loss of glycosylation and substantial decrease in protein expression; when associated with A-74 and A-198.
Beta strand	115 – 120

Literature citations
Molecular cloning and characterization of a human adenocarcinoma/epithelial cell surface antigen complementary DNA.
Strnad J.; Hamilton A.E.; Beavers L.S.; Gamboa G.C.; Apelgren L.D.; Taber L.D.; Sportsman J.R.; Bumol T.F.; Sharp J.D.; Gadski R.A.;
Cancer Res. 49:314-317(1989)
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; VARIANT THR-115; Isolation and characterization of a cDNA encoding the KS1/4 epithelial carcinoma marker.
Perez M.S.; Walker L.E.;
J. Immunol. 142:3662-3667(1989)
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; VARIANT THR-115; Epithelial glycoprotein is a member of a family of epithelial cell surface antigens homologous to nidogen, a matrix adhesion protein.
Simon B.; Podolsky D.K.; Moldenhauer G.; Isselbacher K.J.; Gattoni-Celli S.; Brand S.J.;
Proc. Natl. Acad. Sci. U.S.A. 87:2755-2759(1990)
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; VARIANT THR-115; The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
The MGC Project Team;
Genome Res. 14:2121-2127(2004)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]; VARIANT THR-115;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.