UniProtKB/Swiss-Prot O00206: Variant p.Phe443Leu

Toll-like receptor 4
Gene: TLR4
Feedback?

Variant information Variant position:

443 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Phenylalanine (F) to Leucine (L) at position 443 (F443L, p.Phe443Leu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from large size and aromatic (F) to medium size and hydrophobic (L) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Polymorphism:

Allele TLR4*B (Gly-299, Ile-399) is associated with a blunted response to inhaled LPS. Additional information on the polymorphism described.
Other resources:

Links to websites of interest for the variant.

Variant rs5030716 [ dbSNP | Ensembl ]

Sequence information Variant position:

443 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

839 The length of the canonical sequence.
Location on the sequence:

QLEHLDFQHSNLKQMSEFSV F LSLRNLIYLDISHTHTRVAF The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         QLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAF

Gorilla                       QLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAF

Mouse                         ELQHLDFQHSTLKRVTEFSAFLSLEKLLYLDISYTNTKIDF

Rat                           ELEYLDFQHSTLKKVTEFSVFLSLEKLLYLDISYTNTKIDF

Pig                           QLEYLDFQHSSLKQANDFSIFLSLRNLHYLDISYTNIHVVF

Bovine                        QLEHLDFQHSTLKQINAFSAFLSLRNLRYLDISYTNIRIVF

Cat                           QLEYLDFQHSSLKQVSDFSVFLPLKNLRYLDISYTHTQVAF

Horse                         QLEHLDFQHSTLKQASDFPVFLSLKNLRYLDISYTNTRVVF

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	24 – 839	Toll-like receptor 4
Topological domain	24 – 631	Extracellular
Repeat	423 – 444	LRR 13
Mutagenesis	431 – 431	H -> A. Partially diminishes NF-kappa-B activation induced by Ni(2+). Strongly reduces NF-kappa-B activation induced by Ni(2+); when associated with A-456 or A-458.
Mutagenesis	456 – 456	H -> A. Partially diminishes NF-kappa-B activation induced by Ni(2+). Strongly reduces NF-kappa-B activation induced by Ni(2+); when associated with A-431. Suppresses NF-kappa-B activation induced by Ni(2+); when associated with A-458.
Mutagenesis	458 – 458	H -> A. Partially diminishes NF-kappa-B activation induced by Ni(2+). Strongly reduces NF-kappa-B activation induced by Ni(2+); when associated with A-431. Suppresses NF-kappa-B activation induced by Ni(2+); when associated with A-456.
Turn	438 – 445

Literature citations
Excess of rare amino acid polymorphisms in the Toll-like receptor 4 in humans.
Smirnova I.; Hamblin M.T.; McBride C.; Beutler B.; Di Rienzo A.;
Genetics 158:1657-1664(2001)
Cited for: VARIANTS ARG-188; SER-246; GLY-299; SER-329; ILE-399; LEU-443; LYS-474; HIS-510; ARG-694; HIS-763 AND HIS-834;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.