UniProtKB/SwissProt variant VAR

Variant information

Variant position:

22

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:

Polymorphism

The variants are classified into three categories: Disease, Polymorphism and Unclassified.

Disease: Variants implicated in disease according to literature reports.
Polymorphism: Variants not reported to be implicated in disease.
Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:

From Valine (V) to Methionine (M) at position 22 (V22M, p.Val22Met).

Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:

Similar physico-chemical property. Both residues are medium size and hydrophobic.

The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:

1

The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Variant description:

Polymorphism; does not affect function in DNA repair.

Any additional useful information about the variant.

Other resources:

Links to websites of interest for the variant.

Variant rs3219484 [ dbSNP | Ensembl ]

Sequence information

Variant position:

22

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:

546

The length of the canonical sequence.

Location on the sequence:

TPLVSRLSRLWAIMRKPRAA V GSGHRKQAASQEGRQKHAKN

The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         TPLVSRLSRLWAIMRKPRAAVGSGHRKQAASQEGRQKHAKN

Mouse                         -------------MKKLQASVRS-HKKQPANHKRRRTRALS

Rat                           -------------MKKLRASVRS-HKKQPANHKRRGKCALS

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 546	Adenine DNA glycosylase

Literature citations

Submission
NIEHS SNPs program;
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANTS MET-22; HIS-335; GLU-500; MET-526 AND GLN-531;

Multiple colorectal adenomas, classic adenomatous polyposis, and germ-line mutations in MYH.
Sieber O.M.; Lipton L.; Crabtree M.; Heinimann K.; Fidalgo P.; Phillips R.K.S.; Bisgaard M.-L.; Orntoft T.F.; Aaltonen L.A.; Hodgson S.V.; Thomas H.J.W.; Tomlinson I.P.M.;
N. Engl. J. Med. 348:791-799(2003)
Cited for: VARIANTS FAP2 CYS-176 AND ASP-393; VARIANTS MET-22; HIS-335 AND PHE-512;

Mutations of APC and MYH in unrelated Italian patients with adenomatous polyposis coli.
Aceto G.; Curia M.C.; Veschi S.; De Lellis L.; Mammarella S.; Catalano T.; Stuppia L.; Palka G.; Valanzano R.; Tonelli F.; Casale V.; Stigliano V.; Cetta F.; Battista P.; Mariani-Costantini R.; Cama A.;
Hum. Mutat. 26:394-394(2005)
Cited for: VARIANTS FAP2 CYS-176; HIS-242; TRP-271; PRO-385; ASP-393; CYS-423 AND GLU-477 DEL; VARIANTS MET-22 AND HIS-335;

Low frequency of AXIN2 mutations and high frequency of MUTYH mutations in patients with multiple polyposis.
Lejeune S.; Guillemot F.; Triboulet J.P.; Cattan S.; Mouton C.; Porchet N.; Manouvrier S.; Buisine M.P.;
Hum. Mutat. 27:1064-1064(2006)
Cited for: VARIANTS FAP2 CYS-176; SER-177; VAL-280; LEU-292; PRO-385 AND ASP-393; VARIANTS MET-22; HIS-335 AND PHE-512;

Prevalence of MYH germline mutations in Swiss APC mutation-negative polyposis patients.
Russell A.M.; Zhang J.; Luz J.; Hutter P.; Chappuis P.O.; Berthod C.R.; Maillet P.; Mueller H.; Heinimann K.;
Int. J. Cancer 118:1937-1940(2006)
Cited for: VARIANTS FAP2 ILE-TRP-148 INS; CYS-176; GLN-182; VAL-220; HIS-242 AND ASP-393; VARIANTS MET-22 AND HIS-335;

Functional complementation assay for 47 MUTYH variants in a MutY-disrupted Escherichia coli strain.
Komine K.; Shimodaira H.; Takao M.; Soeda H.; Zhang X.; Takahashi M.; Ishioka C.;
Hum. Mutat. 36:704-711(2015)
Cited for: CHARACTERIZATION OF VARIANTS FAP2 LEU-18; HIS-125; ARG-128; LEU-154; CYS-176; CYS-179; HIS-179; GLN-182; GLU-186; VAL-220; TRP-238; HIS-242; TRP-271; GLU-283; LEU-292; CYS-306; THR-377; PRO-385; ASP-393; LEU-402; MET-417; CYS-423; ASP-470; THR-470; GLU-477 DEL; THR-486 AND PHE-490; CHARACTERIZATION OF VARIANTS GASC SER-402 AND ARG-411; CHARACTERIZATION OF VARIANTS MET-22; ASP-25; ARG-100; ASN-102; VAL-224; MET-231; CYS-242; PHE-243; TRP-287; HIS-335; ARG-335; GLN-434; PRO-434; GLU-500; PHE-512; LEU-513; MET-526 AND GLN-531; FUNCTION; SUBCELLULAR LOCATION;

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9UIF7: Variant p.Val22Met