UniProtKB/Swiss-Prot O96017: Variant p.Pro85Leu

Serine/threonine-protein kinase Chk2
Gene: CHEK2
Feedback?

Variant information Variant position:

85 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Proline (P) to Leucine (L) at position 85 (P85L, p.Pro85Leu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

Found in an osteogenic sarcoma sample; somatic mutation. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs17883862 [ dbSNP | Ensembl ]

Sequence information Variant position:

85 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

543 The length of the canonical sequence.
Location on the sequence:

TVSTQELYSIPEDQEPEDQE P EEPTPAPWARLWALQDGFAN The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         TVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFAN

Mouse                         TVSTQELCSI-----PEDQEPEEPGPAPWARLWALQDGFSN

Caenorhabditis elegans        TMPVDEDLVV--------GESQCAASKPFAKLVGVRRGISS

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 543	Serine/threonine-protein kinase Chk2
Modified residue	68 – 68	Phosphothreonine; by ATM and MAP3K20
Modified residue	73 – 73	Phosphoserine; by PLK3
Alternative sequence	1 – 221	Missing. In isoform 13.
Alternative sequence	75 – 392	Missing. In isoform 11.
Mutagenesis	68 – 68	T -> A. Loss of activation and phosphorylation.
Mutagenesis	73 – 73	S -> A. Impaired activation, phosphorylation by ATM and G2/M transition checkpoint.

Literature citations
Submission
NIEHS SNPs program;
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; VARIANTS LEU-85; THR-157; MET-436; LYS-446; ILE-447; SER-448; LYS-501 AND VAL-512; Mutations of the CHK2 gene are found in some osteosarcomas, but are rare in breast, lung, and ovarian tumors.
Miller C.W.; Ikezoe T.; Krug U.; Hofmann W.K.; Tavor S.; Vegesna V.; Tsukasaki K.; Takeuchi S.; Koeffler H.P.;
Genes Chromosomes Cancer 33:17-21(2002)
Cited for: VARIANTS SER-17 AND LEU-85; INVOLVEMENT IN OSRC; Functional and genomic approaches reveal an ancient CHEK2 allele associated with breast cancer in the Ashkenazi Jewish population.
Shaag A.; Walsh T.; Renbaum P.; Kirchhoff T.; Nafa K.; Shiovitz S.; Mandell J.B.; Welcsh P.; Lee M.K.; Ellis N.; Offit K.; Levy-Lahad E.; King M.-C.;
Hum. Mol. Genet. 14:555-563(2005)
Cited for: VARIANTS LEU-85 AND PHE-428;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.