UniProtKB/Swiss-Prot Q14524: Variant p.Tyr1795Cys

Sodium channel protein type 5 subunit alpha
Gene: SCN5A
Feedback?

Variant information Variant position:

1795 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Tyrosine (Y) to Cysteine (C) at position 1795 (Y1795C, p.Tyr1795Cys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from large size and aromatic (Y) to medium size and polar (C) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

In LQT3; also in a family associating LQT syndrome and atrial fibrillation; slows the onset of activation, but does not cause a marked negative shift in the voltage dependence of inactivation or affect the kinetics of the recovery from inactivation; increases the expression of sustained Na(+) channel activity and promotes entrance into an intermediate or slowly developing inactivated state. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs137854614 [ dbSNP | Ensembl ]

Sequence information Variant position:

1795 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

2016 The length of the canonical sequence.
Location on the sequence:

FSVATEESTEPLSEDDFDMF Y EIWEKFDPEATQFIEYSVLS The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         FSVATEESTEPLSEDDFDMFYEIWEKFDPEATQFIEYSVLS

Mouse                         FSVATEESTEPLSEDDFDMFYEIWEKFDPEATQFIEYLALS

Rat                           FSVATEESTEPLSEDDFDMFYEIWEKFDPEATQFIEYLALS

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 2016	Sodium channel protein type 5 subunit alpha
Topological domain	1772 – 2016	Cytoplasmic
Repeat	1510 – 1807	IV
Helix	1788 – 1801

Literature citations
Inherited Brugada and long QT-3 syndrome mutations of a single residue of the cardiac sodium channel confer distinct channel and clinical phenotypes.
Rivolta I.; Abriel H.; Tateyama M.; Liu H.; Memmi M.; Vardas P.; Napolitano C.; Priori S.G.; Kass R.S.;
J. Biol. Chem. 276:30623-30630(2001)
Cited for: CHARACTERIZATION OF VARIANT LQT3 CYS-1795; CHARACTERIZATION OF VARIANT BRGDA1 HIS-1795; Compendium of cardiac channel mutations in 541 consecutive unrelated patients referred for long QT syndrome genetic testing.
Tester D.J.; Will M.L.; Haglund C.M.; Ackerman M.J.;
Heart Rhythm 2:507-517(2005)
Cited for: VARIANTS LQT3 LEU-125; LYS-245; GLN-404; LYS-406; MET-411; LYS-462; ASP-572; GLU-615; LEU-637; LEU-648; CYS-971; MET-1069; LYS-1225; LYS-1231; SER-1325; TYR-1458; GLU-1481; 1505-LYS--GLN-1507 DEL; LEU-1623; HIS-1644; ILE-1667; MET-1763; LEU-1766; MET-1777; MET-1779; LYS-1784; CYS-1795; ARG-1909 AND SER-1949; VARIANTS TRP-18; PHE-618 AND GLN-1958; A mutation in the sodium channel is responsible for the association of long QT syndrome and familial atrial fibrillation.
Benito B.; Brugada R.; Perich R.M.; Lizotte E.; Cinca J.; Mont L.; Berruezo A.; Tolosana J.M.; Freixa X.; Brugada P.; Brugada J.;
Heart Rhythm 5:1434-1440(2008)
Cited for: VARIANT LQT3 CYS-1795; Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test.
Kapplinger J.D.; Tester D.J.; Salisbury B.A.; Carr J.L.; Harris-Kerr C.; Pollevick G.D.; Wilde A.A.; Ackerman M.J.;
Heart Rhythm 6:1297-1303(2009)
Cited for: VARIANTS LQT3 GLN-18; HIS-27; GLY-30; GLN-43; LYS-48; SER-52; GLN-53; GLY-104; GLY-115; LEU-125; PRO-212; GLN-222; TRP-225; MET-240; LEU-247; LYS-275; SER-289; TRP-340; CYS-367; MET-370; THR-397; LYS-406; VAL-409; MET-411; GLU-429 DEL; ALA-462; VAL-530; GLN-535; TRP-569; ILE-571; SER-572; VAL-572; 586-ALA-LEU-587 DEL; GLU-615; ARG-639; LYS-654; PRO-673; CYS-689; LEU-701; ILE-731; ARG-750; ASN-772; TYR-816; PHE-848; LYS-960; LEU-965; PHE-981; SER-997; ARG-1004; LYS-1053; MET-1069; VAL-1100; ASN-1114; ASN-1166; SER-1199; ILE-1212 DEL; MET-1283; MET-1304; SER-1325; SER-1326; VAL-1334; VAL-1338; SER-1432; SER-1472; CYS-1473; GLU-1481; LEU-1487; ARG-1488; ASP-1489; ARG-1493; SER-1495; VAL-1498; VAL-1501; ASN-1505; ILE-1532; PHE-1560; MET-1593; SER-1594; ILE-1596; PHE-1617 DEL; GLN-1623; LEU-1623; HIS-1626; CYS-1644; PHE-1650; THR-1652; ASN-1723; TRP-1739; HIS-1761; PHE-1761; MET-1763; MET-1777; MET-1779; LYS-1784; CYS-1795; HIS-1826; GLY-1839; TRP-1897; GLN-1901; ASN-1977; VAL-2004 AND CYS-2012;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.