Home  |  Contact

UniProtKB/Swiss-Prot P49821: Variant p.Glu214Lys

NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
Gene: NDUFV1
Variant information

Variant position:  214
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Glutamate (E) to Lysine (K) at position 214 (E214K, p.Glu214Lys).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and acidic (E) to large size and basic (K)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Mitochondrial complex I deficiency, nuclear type 4 (MC1DN4) [MIM:618225]: A form of mitochondrial complex I deficiency, the most common biochemical signature of mitochondrial disorders, a group of highly heterogeneous conditions characterized by defective oxidative phosphorylation, which collectively affects 1 in 5-10000 live births. Clinical disorders have variable severity, ranging from lethal neonatal disease to adult-onset neurodegenerative disorders. Phenotypes include macrocephaly with progressive leukodystrophy, non-specific encephalopathy, cardiomyopathy, myopathy, liver disease, Leigh syndrome, Leber hereditary optic neuropathy, and some forms of Parkinson disease. MC1DN4 transmission pattern is consistent with autosomal recessive inheritance. {ECO:0000269|PubMed:10080174, ECO:0000269|PubMed:11349233}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In MC1DN4.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  214
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  464
The length of the canonical sequence.

Location on the sequence:   DVFVVRGAGAYICGEETALI  E SIEGKQGKPRLKPPFPADVG
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         DVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVG

Gorilla                       DVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVG

Chimpanzee                    DVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVG

Mouse                         DVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVG

Bovine                        DVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVG

Slime mold                    DVYVHRGAGAYICGEETALIESIEGKQGKPRLKPPFPAMAG

Fission yeast                 ELLIHPGAGSYITGEESALIQSLQGEFPVPDIPINNTITSG

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 21 – 464 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
Nucleotide binding 199 – 247 FMN
Helix 209 – 216


Literature citations

Large-scale deletion and point mutations of the nuclear NDUFV1 and NDUFS1 genes in mitochondrial complex I deficiency.
Benit P.; Chretien D.; Kadhom N.; de Lonlay-Debeney P.; Cormier-Daire V.; Cabral A.; Peudenier S.; Rustin P.; Munnich A.; Roetig A.;
Am. J. Hum. Genet. 68:1344-1352(2001)
Cited for: INVOLVEMENT IN MC1DN4; VARIANT MC1DN4 LYS-214;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.