Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P10636: Variant p.Leu583Val

Microtubule-associated protein tau
Gene: MAPT
Feedback?
Variant information Variant position: help 583 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Leucine (L) to Valine (V) at position 583 (L583V, p.Leu583Val). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In FTD; less able to promote microtubule assembly than wild-type tau. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 583 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 758 The length of the canonical sequence.
Location on the sequence: help APVPMPDLKNVKSKIGSTEN L KHQPGGGKVQIINKKLDLSN The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         APVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSN

Gorilla                       APVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSN

Rhesus macaque                APVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSN

Chimpanzee                    APVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSN

Mouse                         APVPMPDLKNVRSKIGSTENLKHQPGGGKVQIINKKLDLSN

Rat                           APVPMPDLKNVRSKIGSTENLKHQPGGGKVQIINKKLDLSN

Bovine                        APGPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSN

Goat                          APGPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSN
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 2 – 758 Microtubule-associated protein tau
Repeat 561 – 591 Tau/MAP 1
Region 561 – 685 Microtubule-binding domain
Site 571 – 571 Not glycated
Site 574 – 574 Not glycated
Site 584 – 584 Not glycated
Site 591 – 591 Not glycated
Modified residue 576 – 576 N6-acetyllysine; alternate
Modified residue 576 – 576 N6-methyllysine; alternate
Modified residue 579 – 579 Phosphoserine; by MARK1, MARK2, MARK3, MARK4, BRSK1, BRSK2 and PHK
Modified residue 596 – 596 Deamidated asparagine; in tau and PHF-tau; partial
Modified residue 598 – 598 N6-acetyllysine; alternate
Modified residue 602 – 602 Phosphoserine; by PHK
Glycosylation 576 – 576 N-linked (Glc) (glycation) lysine; in PHF-tau; in vitro
Glycosylation 597 – 597 N-linked (Glc) (glycation) lysine; in PHF-tau; in vitro
Glycosylation 598 – 598 N-linked (Glc) (glycation) lysine; in PHF-tau; in vitro
Cross 571 – 571 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); in PHF-tau
Cross 576 – 576 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate
Cross 584 – 584 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Cross 598 – 598 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate
Mutagenesis 579 – 579 S -> A. 8% decrease in microtubule-binding after in vitro phosphorylation of mutant protein.



Literature citations
A novel L266V mutation of the tau gene causes frontotemporal dementia with a unique tau pathology.
Kobayashi T.; Ota S.; Tanaka K.; Ito Y.; Hasegawa M.; Umeda Y.; Motoi Y.; Takanashi M.; Yasuhara M.; Anno M.; Mizuno Y.; Mori H.;
Ann. Neurol. 53:133-137(2003)
Cited for: VARIANT FTD VAL-583; CHARACTERIZATION OF VARIANT FTD VAL-583;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.