Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O60260: Variant p.Arg366Trp

E3 ubiquitin-protein ligase parkin
Gene: PRKN
Feedback?
Variant information Variant position: help 366 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Tryptophan (W) at position 366 (R366W, p.Arg366Trp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to large size and aromatic (W) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 366 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 465 The length of the canonical sequence.
Location on the sequence: help DQRKVTCEGGNGLGCGFAFC R ECKEAYHEGECSAVFEASGT The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         DQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGT

Mouse                         GQRKVTCEGGNGLGCGFVFCRDCKEAYHEGDCDSLLEPSGA

Rat                           GQKKVTCEGGNGLGCGFVFCRDCKEAYHEGECDSMFEASGA

Drosophila                    DCRKVTCQN----GCGYVFCRNCLQGYHIGEC--LPEGTGA

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 465 E3 ubiquitin-protein ligase parkin
Zinc finger 313 – 377 IBR-type
Region 234 – 465 TRIAD supradomain
Binding site 352 – 352
Binding site 360 – 360
Binding site 365 – 365
Binding site 368 – 368
Binding site 373 – 373
Binding site 377 – 377
Cross 349 – 349 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ISG15)
Cross 369 – 369 Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ISG15)
Alternative sequence 298 – 465 Missing. In isoform 3.
Alternative sequence 362 – 368 FAFCREC -> YGQRRTK. In isoform 5.
Mutagenesis 365 – 365 C -> S. Impairs protein folding.
Turn 366 – 368



Literature citations
Polymorphisms of the parkin gene in sporadic Parkinson's disease among Chinese in Taiwan.
Hu C.-J.; Sung S.-M.; Liu H.-C.; Lee C.-C.; Tsai C.-H.; Chang J.-G.;
Eur. Neurol. 44:90-93(2000)
Cited for: VARIANTS ASN-167; TRP-366 AND LEU-380;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.