Home  |  Contact

UniProtKB/Swiss-Prot O15438: Variant p.Arg1297His

ATP-binding cassette sub-family C member 3
Gene: ABCC3
Variant information

Variant position:  1297
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LB/B
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Arginine (R) to Histidine (H) at position 1297 (R1297H, p.Arg1297His).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to medium size and polar (H)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  Does not affect subcellular localizattion; does not affect the transport of monoglucuronosyl bilirubin, bisglucuronosyl bilirubin, leukotriene C4, dehydroepiandrosterone-3-sulfate and 17-beta-glucuronosyl oestradiol.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  1297
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1527
The length of the canonical sequence.

Location on the sequence:   SRPPEGWPPRGEVEFRNYSV  R YRPGLDLVLRDLSLHVHGGE
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         SRPPEGWPPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGE

Mouse                         NRAPEGWPTRGMVEFRNYSVRYRPGLELVLKNVTVHVQGGE

Rat                           NRAPEGWPRSGVVEFRNYSVRYRPGLELVLKNLTLHVQGGE

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 1527 ATP-binding cassette sub-family C member 3
Topological domain 1244 – 1527 Cytoplasmic
Domain 1291 – 1523 ABC transporter 2
Alternative sequence 511 – 1527 Missing. In isoform 3.
Alternative sequence 573 – 1527 Missing. In isoform 5.
Alternative sequence 1194 – 1527 WLSIGVEFVGNCVVLFAALFAVIGRSSLNPGLVGLSVSYSLQVTFALNWMIRMMSDLESNIVAVERVKEYSKTETEAPWVVEGSRPPEGWPPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVGIVGRTGAGKSSMTLCLFRILEAAKGEIRIDGLNVADIGLHDLRSQLTIIPQDPILFSGTLRMNLDPFGSYSEEDIWWALELSHLHTFVSSQPAGLDFQCSEGGENLSVGQRQLVCLARALLRKSRILVLDEATAAIDLETDNLIQATIRTQFDTCTVLTIAHRLNTIMDYTRVLVLDKGVVAEFDSPANLIAARGIFYGMARDAGLA -> SEAASLAPCSSRNSQQALWCSGSLSLLSPKQKTGPALPLPHFLLI. In isoform 2.


Literature citations

Identification and functional characterization of the natural variant MRP3-Arg1297His of human multidrug resistance protein 3 (MRP3/ABCC3).
Lee Y.M.; Cui Y.; Koenig J.; Risch A.; Jaeger B.; Drings P.; Bartsch H.; Keppler D.; Nies A.T.;
Pharmacogenetics 14:213-223(2004)
Cited for: FUNCTION; CATALYTIC ACTIVITY; VARIANTS GLN-548 AND HIS-1297; CHARACTERIZATION OF VARIANT HIS-1297; SUBCELLULAR LOCATION; BIOPHYSICOCHEMICAL PROPERTIES;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.