UniProtKB/SwissProt variant VAR

Variant information

Variant position:

1210

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:

US

The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Glutamate (E) to Glycine (G) at position 1210 (E1210G, p.Glu1210Gly).

Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:

Change from medium size and acidic (E) to glycine (G)

The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:

-2

The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Variant description:

In BC; unknown pathological significance.

Any additional useful information about the variant.

Other resources:

Links to websites of interest for the variant.

Variant rs1060502347 [ dbSNP | Ensembl ]

Sequence information

Variant position:

1210

The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:

1863

The length of the canonical sequence.

Location on the sequence:

PSPFTHTHLAQGYRRGAKKL E SSEENLSSEDEELPCFQHLL

The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         PSPFTHTHLAQGYRRGAKKLESSEENLSSEDEELPCFQHLL

Gorilla                       PSPFTHTHLAQGYRRGAKKLESSEENLSSEDEELPCFQHLL

                              PSPSDHTRLAQGYQRGTKKLESSEENMSSEEEELPCFQHLI

Rhesus macaque                PSPFTHTHLAQGYQKEAKKLESSEENLSSEDEELPCFQHLL

Chimpanzee                    PSPFTHTHLAQGYRRGAKKLESSEENLSSEDEELPCFQHLL

Mouse                         PSPVTHASKSQSLHRASRKLESSEESDSTEDEDLPCFQHLL

Rat                           PSPVTHASKSRSLHRGSRKLEFSEESDSTEDEDLPCFQHLL

Bovine                        PGPFTHTHLAQGHQRGAGKLE-SEETVSSEDEELPCFQQLL

Caenorhabditis elegans        PEPI--------------------QKLAQKPEVFKSTQNLI

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 1863	Breast cancer type 1 susceptibility protein
Region	1181 – 1216	Disordered
Modified residue	1191 – 1191	Phosphoserine
Modified residue	1211 – 1211	Phosphoserine
Modified residue	1217 – 1217	Phosphoserine
Modified residue	1218 – 1218	Phosphoserine
Alternative sequence	64 – 1863	Missing. In isoform 2.
Alternative sequence	224 – 1365	Missing. In isoform 5.
Alternative sequence	264 – 1366	Missing. In isoform 3 and isoform 6.

Literature citations

Twenty-three novel BRCA1 and BRCA2 sequence alterations in breast and/or ovarian cancer families in Southern Germany.
Meyer P.; Voigtlaender T.; Bartram C.R.; Klaes R.;
Hum. Mutat. 22:259-259(2003)
Cited for: VARIANTS BC GLY-61; LYS-71; GLN-866; TYR-888; ILE-1139; GLY-1210 AND PRO-1297; VARIANTS BROVCA1 TYR-835 AND PRO-1786;

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P38398: Variant p.Glu1210Gly