UniProtKB/Swiss-Prot Q9BX63: Variant p.Ser919Pro

Fanconi anemia group J protein
Gene: BRIP1
Feedback?

Variant information Variant position:

919 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Serine (S) to Proline (P) at position 919 (S919P, p.Ser919Pro). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from small size and polar (S) to medium size and hydrophobic (P) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs4986764 [ dbSNP | Ensembl ]

Sequence information Variant position:

919 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

1249 The length of the canonical sequence.
Location on the sequence:

RTNIQDNESTLEVTSLKYST S PYLLEAASHLSPENFVEDEA The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         RTNIQDNESTLEVTSLKYSTSPYLLEAASHLSPENFVEDEA

Mouse                         EKCTKDNEPTLEVACLEDSTFTSVSESS-HQSPENSTE-EA

Chicken                       ----CSNEVFHVPLNSKEPSSASQQEATIHLSPDVPVKSEE

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 1249	Fanconi anemia group J protein
Region	888 – 1063	Interaction with BRCA1
Modified residue	927 – 927	Phosphoserine
Modified residue	930 – 930	Phosphoserine

Literature citations
BACH1, a novel helicase-like protein, interacts directly with BRCA1 and contributes to its DNA repair function.
Cantor S.B.; Bell D.W.; Ganesan S.; Kass E.M.; Drapkin R.; Grossman S.; Wahrer D.C.R.; Sgroi D.C.; Lane W.S.; Haber D.A.; Livingston D.M.;
Cell 105:149-160(2001)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); PROTEIN SEQUENCE OF 708-747; 765-790; 815-831; 1079-1085; 1169-1174 AND 1215-1225; FUNCTION; TISSUE SPECIFICITY; SUBCELLULAR LOCATION; INTERACTION WITH BRCA1; MUTAGENESIS OF LYS-52; VARIANTS BC ALA-47 AND ILE-299; VARIANTS ILE-193 AND PRO-919; IDENTIFICATION BY MASS SPECTROMETRY; The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
The MGC Project Team;
Genome Res. 14:2121-2127(2004)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1); VARIANT PRO-919; BACH1 is critical for homologous recombination and appears to be the Fanconi anemia gene product FANCJ.
Litman R.; Peng M.; Jin Z.; Zhang F.; Zhang J.; Powell S.; Andreassen P.R.; Cantor S.B.;
Cancer Cell 8:255-265(2005)
Cited for: FUNCTION; VARIANT PRO-919; DISEASE; No mutations in the BACH1 gene in BRCA1 and BRCA2 negative breast-cancer families linked to 17q22.
Luo L.; Lei H.; Du Q.; von Wachenfeldt A.; Kockum I.; Luthman H.; Vorechovsky I.; Lindblom A.;
Int. J. Cancer 98:638-639(2002)
Cited for: VARIANTS CYS-173 AND PRO-919; No evidence of involvement of germline BACH1 mutations in Finnish breast and ovarian cancer families.
Karppinen S.-M.; Vuosku J.; Heikkinen K.; Allinen M.; Winqvist R.;
Eur. J. Cancer 39:366-371(2003)
Cited for: VARIANTS PRO-919 AND LEU-1034; Mutational analysis of the BRCA1-interacting genes ZNF350/ZBRK1 and BRIP1/BACH1 among BRCA1 and BRCA2-negative probands from breast-ovarian cancer families and among early-onset breast cancer cases and reference individuals.
Rutter J.L.; Smith A.M.; Davila M.R.; Sigurdson A.J.; Giusti R.M.; Pineda M.A.; Doody M.M.; Tucker M.A.; Greene M.H.; Zhang J.; Struewing J.P.;
Hum. Mutat. 22:121-128(2003)
Cited for: VARIANTS CYS-173; ILE-193; PRO-195; TRP-419; VAL-531; LEU-540; TYR-832; PRO-919 AND GLY-935; DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome.
Ley T.J.; Mardis E.R.; Ding L.; Fulton B.; McLellan M.D.; Chen K.; Dooling D.; Dunford-Shore B.H.; McGrath S.; Hickenbotham M.; Cook L.; Abbott R.; Larson D.E.; Koboldt D.C.; Pohl C.; Smith S.; Hawkins A.; Abbott S.; Locke D.; Hillier L.W.; Miner T.; Fulton L.; Magrini V.; Wylie T.; Glasscock J.; Conyers J.; Sander N.; Shi X.; Osborne J.R.; Minx P.; Gordon D.; Chinwalla A.; Zhao Y.; Ries R.E.; Payton J.E.; Westervelt P.; Tomasson M.H.; Watson M.; Baty J.; Ivanovich J.; Heath S.; Shannon W.D.; Nagarajan R.; Walter M.J.; Link D.C.; Graubert T.A.; DiPersio J.F.; Wilson R.K.;
Nature 456:66-72(2008)
Cited for: VARIANT [LARGE SCALE ANALYSIS] PRO-919;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.