Home  |  Contact
Due to work on this service, it may not be fully operational on Wednesday March 20 between 1.30 pm and 2.30 pm CEST. Apologies for the inconvenience.

UniProtKB/Swiss-Prot P40939: Variant p.Leu342Pro

Trifunctional enzyme subunit alpha, mitochondrial
Gene: HADHA
Chromosomal location: 2p23
Variant information

Variant position:  342
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Leucine (L) to Proline (P) at position 342 (L342P, p.Leu342Pro).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Similar physico-chemical property. Both residues are medium size and hydrophobic.
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Long-chain 3-hydroxyl-CoA dehydrogenase deficiency (LCHAD deficiency) [MIM:609016]: The clinical features are very similar to TFP deficiency. Biochemically, LCHAD deficiency is characterized by reduced long-chain 3-hydroxyl-CoA dehydrogenase activity, while the other enzyme activities of the TFP complex are normal or only slightly reduced. {ECO:0000269|PubMed:7811722, ECO:0000269|PubMed:9266371}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In LCHAD deficiency.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  342
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  763
The length of the canonical sequence.

Location on the sequence:   CESQKFGELVMTKESKALMG  L YHGQVLCKKNKFGAPQKDVK
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         CESQKFGELVMTKESKALMGLYHGQVLCKKNKFGAPQKDVK

Mouse                         AESQKFGELALTKESKALMGLYNGQVLCKKNKFGAPQKNVQ

Rat                           AESEKFGELALTKESKALMGLYNGQVLCKKNKFGAPQKTVQ

Pig                           SESQKFGELAMTKESKALMGLYRGQTLCKKNKFGAPQKEVK

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 37 – 763 Trifunctional enzyme subunit alpha, mitochondrial
Modified residue 326 – 326 N6-acetyllysine; alternate
Modified residue 326 – 326 N6-succinyllysine; alternate
Modified residue 334 – 334 N6-acetyllysine; alternate
Modified residue 334 – 334 N6-succinyllysine; alternate
Modified residue 350 – 350 N6-acetyllysine; alternate
Modified residue 350 – 350 N6-succinyllysine; alternate
Modified residue 353 – 353 N6-acetyllysine
Alternative sequence 83 – 763 Missing. In isoform 2.


Literature citations

Molecular basis of long-chain 3-hydroxyacyl-CoA dehydrogenase deficiency: identification of two new mutations.
Ijlst L.; Oostheim W.; Ruiter J.P.N.; Wanders R.J.A.;
J. Inherit. Metab. Dis. 20:420-422(1997)
Cited for: VARIANTS LCHAD DEFICIENCY PRO-342 AND GLN-510;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.