UniProtKB/Swiss-Prot P22033: Variant p.Gly203Arg

Methylmalonyl-CoA mutase, mitochondrial
Gene: MMUT
Feedback?

Variant information Variant position:

203 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Glycine (G) to Arginine (R) at position 203 (G203R, p.Gly203Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from glycine (G) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

In MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs778702777 [ dbSNP | Ensembl ]

Sequence information Variant position:

203 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

750 The length of the canonical sequence.
Location on the sequence:

SVSMTMNGAVIPVLANFIVT G EEQGVPKEKLTGTIQNDILK The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         SVSMTMNGAVIPVLANFIVTGEEQGVPKEKLTGTIQNDILK

Mouse                         SVSMTMNGAVIPVLATFIVTGEEQGVPKEKLTGTIQNDILK

Pig                           SVSMTMNGAVIPVLATFIVSGEEQGVPKEKLTGTIQNDILK

Bovine                        SVSMTMNGAVIPVLATFIVTGEEQGVPKEKLTGTIQNDILK

Caenorhabditis elegans        SVSMTMNGAVVPVLAMYVVAAEEAGVSRKLLAGTIQNDILK

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	33 – 750	Methylmalonyl-CoA mutase, mitochondrial
Modified residue	212 – 212	N6-acetyllysine
Helix	192 – 205

Literature citations
mut0 methylmalonic acidemia: eleven novel mutations of the methylmalonyl CoA mutase including a deletion-insertion mutation.
Fuchshuber A.; Mucha B.; Baumgartner E.R.; Vollmer M.; Hildebrandt F.;
Hum. Mutat. 16:179-179(2000)
Cited for: VARIANTS MMAM VAL-137; SER-174; ARG-203; HIS-218; PRO-535 AND ARG-627; Molecular basis of methylmalonyl-CoA mutase apoenzyme defect in 40 European patients affected by mut(o) and mut- forms of methylmalonic acidemia: identification of 29 novel mutations in the MUT gene.
Acquaviva C.; Benoist J.-F.; Pereira S.; Callebaut I.; Koskas T.; Porquet D.; Elion J.;
Hum. Mutat. 25:167-176(2005)
Cited for: VARIANTS MMAM HIS-108; LEU-148; ASN-156; VAL-158; GLU-191; ARG-203; SER-215; TYR-219; ASN-262; PRO-293; PHE-328; CYS-587; THR-615; ASN-621; ARG-623; ARG-624; ARG-627; GLU-637; ILE-638; TYR-640; ARG-642; TRP-694 AND LYS-700; Spectrum of mutations in mut methylmalonic acidemia and identification of a common Hispanic mutation and haplotype.
Worgan L.C.; Niles K.; Tirone J.C.; Hofmann A.; Verner A.; Sammak A.; Kucic T.; Lepage P.; Rosenblatt D.S.;
Hum. Mutat. 27:31-43(2006)
Cited for: VARIANTS MMAM LEU-86; GLU-87; HIS-93; ARG-94; VAL-94; ARG-95; ARG-105; CYS-108; GLY-108; HIS-108; SER-145; SER-174; VAL-186; LYS-189; GLU-191; GLU-197; ARG-203; CYS-215; SER-215; HIS-218; TYR-219; GLN-228; ILE-230; ASN-231; ASN-262; TYR-265; SER-281; GLU-291; SER-305; PHE-306; VAL-312; CYS-316; THR-324; LEU-346 DEL; ARG-347; TYR-350; CYS-369; HIS-369; PRO-370; GLU-377; HIS-383; PRO-383; ARG-386; ASN-386; HIS-388; SER-389 DEL; ILE-412 DEL; ARG-426; ASP-427; PRO-518; TYR-560; ARG-566; SER-573; ARG-615; CYS-616; ARG-623; GLU-630; GLY-633; ARG-637; ARG-642; ARG-678; ARG-685; TRP-694; LYS-700; ARG-703 AND VAL-717; VARIANTS VAL-69; THR-499; HIS-532 AND VAL-671; Mutation and biochemical analysis of 19 probands with mut0 and 13 with mut- methylmalonic aciduria: identification of seven novel mutations.
Lempp T.J.; Suormala T.; Siegenthaler R.; Baumgartner E.R.; Fowler B.; Steinmann B.; Baumgartner M.R.;
Mol. Genet. Metab. 90:284-290(2007)
Cited for: VARIANTS MMAM CYS-100; HIS-108; VAL-137; TYR-143; LEU-148; GLU-191; ARG-203; HIS-218; TYR-219; ASN-231; PRO-288; PHE-328; PHE-344; SER-366; HIS-369; GLU-454; THR-615; GLU-630; GLY-633; LEU-694; TRP-694 AND LYS-700; Methylmalonic acidaemia: examination of genotype and biochemical data in 32 patients belonging to mut, cblA or cblB complementation group.
Merinero B.; Perez B.; Perez-Cerda C.; Rincon A.; Desviat L.R.; Martinez M.A.; Sala P.R.; Garcia M.J.; Aldamiz-Echevarria L.; Campos J.; Cornejo V.; Del Toro M.; Mahfoud A.; Martinez-Pardo M.; Parini R.; Pedron C.; Pena-Quintana L.; Perez M.; Pourfarzam M.; Ugarte M.;
J. Inherit. Metab. Dis. 31:55-66(2008)
Cited for: VARIANTS MMAM 7-GLN--VAL-750 DEL; VAL-69; ARG-109; 152-ARG--VAL-750 DEL; GLU-191; ARG-203; TYR-219; 228-ARG--VAL-750 DEL; ASN-231; THR-324; PRO-328; PRO-358; CYS-369; CYS-616; ARG-617 AND TRP-694; Molecular genetic characterization of 151 mut-type methylmalonic aciduria patients and identification of 41 novel mutations in MUT.
Forny P.; Schnellmann A.S.; Buerer C.; Lutz S.; Fowler B.; Froese D.S.; Baumgartner M.R.;
Hum. Mutat. 37:745-754(2016)
Cited for: VARIANTS MMAM LYS-126; ARG-133; ASN-139; VAL-156; ARG-161; SER-187; ILE-189; GLU-205 DEL; ARG-230; ASP-276; ARG-284; GLU-284; ASP-325; LYS-326; LYS-388; LEU-424; GLU-426; VAL-552; PRO-618 AND GLY-625; CHARACTERIZATION OF VARIANTS MMAM HIS-93; ARG-133; ARG-161; ILE-189; GLU-191; ARG-203; ARG-230; PRO-288; SER-305; GLU-377; LYS-388; LEU-424; GLU-426; LEU-615; THR-615; ARG-624; VAL-625; GLY-625; PHE-674 AND TRP-694; FUNCTION; CATALYTIC ACTIVITY;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.