UniProtKB/Swiss-Prot P18850: Variant p.Pro157Ser

Cyclic AMP-dependent transcription factor ATF-6 alpha
Gene: ATF6
Feedback?

Variant information Variant position:

157 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Proline (P) to Serine (S) at position 157 (P157S, p.Pro157Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and hydrophobic (P) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs1135983 [ dbSNP | Ensembl ]

Sequence information Variant position:

157 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

670 The length of the canonical sequence.
Location on the sequence:

ENSNSLSSAEPLKEDKPVTG P RNKTENGLTPKKKIQVNSKP The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         ENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKP

Mouse                         DSCNSPSSVEPLKEEKPVTGPGNKTEHGLTPKKKIQMSSKP

Rat                           DSCHSPSSAEPLKEEKPVTGPGNKTEHGLTPKKKIQMSSKP

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 670	Cyclic AMP-dependent transcription factor ATF-6 alpha
Topological domain	1 – 377	Cytoplasmic
Region	91 – 183	Disordered
Cross	152 – 152	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Mutagenesis	152 – 152	K -> R. Almost complete loss of RNF186-mediated ubiquitination.

Literature citations
Interaction of ATF6 and serum response factor.
Zhu C.; Johansen F.E.; Prywes R.;
Mol. Cell. Biol. 17:4957-4966(1997)
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; TISSUE SPECIFICITY; VARIANTS LEU-67; PRO-145 AND SER-157; Identification of the cis-acting endoplasmic reticulum stress response element responsible for transcriptional induction of mammalian glucose-regulated proteins; involvement of basic-leucine zipper transcription factors.
Yoshida H.; Haze K.; Yanagi H.; Yura T.; Mori K.;
J. Biol. Chem. 273:33741-33749(1998)
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; VARIANTS PRO-145 AND SER-157;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.