UniProtKB/Swiss-Prot Q9Y2D1: Variant p.Pro121Leu

Cyclic AMP-dependent transcription factor ATF-5
Gene: ATF5
Feedback?

Variant information Variant position:

121 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Proline (P) to Leucine (L) at position 121 (P121L, p.Pro121Leu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs283526 [ dbSNP | Ensembl ]

Sequence information Variant position:

121 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

282 The length of the canonical sequence.
Location on the sequence:

MASLLKKELEQMEDFFLDAP P LPPPSPPPLPPPPLPPAPSL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         MASLLKKELEQMEDFFLDAPPLPPPSPPPLPPPPLPPAPSL

Mouse                         MASLLKKELEQMEDFFLDAPLLPPPSPPPPPPPAAAPSLPL

Rat                           MASLLKKELEQMEDFFLDAPLLPPPSPPPPPPPA--PSLPL

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 282	Cyclic AMP-dependent transcription factor ATF-5
Region	116 – 152	Disordered
Region	119 – 217	Interaction with PTP4A1
Compositional bias	118 – 149	Pro residues
Mutagenesis	126 – 126	S -> A. Not phosphorylated; when associated with 92-A--A-94 and A-190.

Literature citations
Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas.
Yamada S.; Ohira M.; Horie H.; Ando K.; Takayasu H.; Suzuki Y.; Sugano S.; Hirata T.; Goto T.; Matsunaga T.; Hiyama E.; Hayashi Y.; Ando H.; Suita S.; Kaneko M.; Sasaki F.; Hashizume K.; Ohnuma N.; Nakagawara A.;
Oncogene 23:5901-5911(2004)
Cited for: NUCLEOTIDE SEQUENCE [MRNA]; VARIANT LEU-121; The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
The MGC Project Team;
Genome Res. 14:2121-2127(2004)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]; VARIANT LEU-121;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.